DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kkv and Has1

DIOPT Version :9

Sequence 1:NP_524233.1 Gene:kkv / 45884 FlyBaseID:FBgn0001311 Length:1615 Species:Drosophila melanogaster
Sequence 2:NP_758826.1 Gene:Has1 / 282821 RGDID:708528 Length:583 Species:Rattus norvegicus


Alignment Length:433 Identity:83/433 - (19%)
Similarity:154/433 - (35%) Gaps:159/433 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   694 PGKTKFITHLKDKDRIRHRKRWS---QVMY-MYYLLGHRLMELPISVDRKDAIAENTYLLTLDGD 754
            ||:......::.:..:...:||.   :||| .:..||.       |||         |:...|.|
  Rat   196 PGRLAVEALVRTRRCVCVAQRWGGKREVMYTAFKALGD-------SVD---------YVQVCDSD 244

  Fly   755 IDFKPNAVTLLVDLMKKNKNLGAACGRI---HPVGSGPMVWYQLFEYAIGHW----LQKATEHMI 812
            ....|.|:..||.::.::..:||..|.:   :|:.|    |.. |..::.:|    :::|.:...
  Rat   245 TRLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDS----WVS-FLSSLRYWVAFNVERACQSYF 304

  Fly   813 GCVLCSPGCFSLFRGKALMDDNVMKKYTTRSDEARHYVQYDQ---------GEDRWLCTLLLQRG 868
            .||.|..|...|:|      :|:::::.    ||    .|:|         |:||.|...:|..|
  Rat   305 HCVSCISGPLGLYR------NNLLQQFL----EA----WYNQKFLGTHCTFGDDRHLTNRMLSMG 355

  Fly   869 YRVEYSAASDAYTHCPEGFNEFYNQRRRWVPSTIANIMDLLADAKRTIKINDNISLLYIFYQMML 933
            |..:|::.|..|:..|..|..:.:|:.||..|                           :::..|
  Rat   356 YATKYTSRSRCYSETPSSFLRWLSQQTRWSKS---------------------------YFREWL 393

  Fly   934 MGGTILGPGTIFLMLVGAFVAAFRIDNWTSFHY---NIVPILAFMFICFTCKSNIQLFVAQVLST 995
            ....                       |...|:   ....:::.:|..|...:.::||.|   ..
  Rat   394 YNAL-----------------------WWHRHHAWMTYEAVVSGLFPFFVAATVLRLFYA---GR 432

  Fly   996 AYALIMMAVIVGTALQLGEDGIGSPSAIF-----------LISMVGSFFIAACLHPQEFWCITCG 1049
            .:||:.:.:.|        .|:....|.|           |:|:....::             ||
  Rat   433 PWALLWVLLCV--------QGVALAKAAFAAWLRGCLRMVLLSLYAPLYM-------------CG 476

  Fly  1050 LIYLLSIPSMYLLLILYSIINLNVVSWGTREVVAKKTKKELEA 1092
            |     :|:.:|     :::.:|...|||      ..:|:|.|
  Rat   477 L-----LPAKFL-----ALVTMNQSGWGT------SGRKKLAA 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kkvNP_524233.1 Chitin_synth_C 583..904 CDD:133033 55/229 (24%)
Has1NP_758826.1 nodulat_NodC 51..493 CDD:275076 77/415 (19%)
Glyco_tranf_GTA_type 100..391 CDD:299700 55/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11041
eggNOG 1 0.900 - - E1_COG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.