DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kkv and Has3

DIOPT Version :9

Sequence 1:NP_524233.1 Gene:kkv / 45884 FlyBaseID:FBgn0001311 Length:1615 Species:Drosophila melanogaster
Sequence 2:NP_758822.1 Gene:Has3 / 266805 RGDID:628656 Length:554 Species:Rattus norvegicus


Alignment Length:425 Identity:88/425 - (20%)
Similarity:163/425 - (38%) Gaps:98/425 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   713 KRWS---QVMY-MYYLLGHRLMELPISVDRKDAIAENTYLLTLDGDIDFKPNAVTLLVDLMKKNK 773
            ::|.   :||| .:..||:       |||         |:...|.|....|.....::.:::::.
  Rat   189 QKWGGKREVMYTAFKALGN-------SVD---------YIQVCDSDTVLDPACTIEMLRVLEEDP 237

  Fly   774 NLGAACGRIHPVGSGPMVWYQLFEYAIGHWL----QKATEHMIGCVLCSPGCFSLFRGKAL---M 831
            .:|...|.:..:..... |.. |..::.:|:    ::|.:...|||.|..|...::|...|   :
  Rat   238 QVGGVGGDVQILNKYDS-WIS-FLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFL 300

  Fly   832 DDNVMKKYTTRSDEARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAYTHCPEGFNEFYNQRRR 896
            :|...:|:...        :...|:||.|...:|..|||.:|:|.|...|..|..:..:.||:.|
  Rat   301 EDWYHQKFLGS--------KCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRWLNQQTR 357

  Fly   897 WVPSTIAN-IMDLLADAKRTIKINDNISLLYIFYQMMLMGGTILGPGTIF-LMLVGAFVAAF--- 956
            |..|.... :.:.|...|..         |::.|:.::.|        .| ..|:...:..|   
  Rat   358 WSKSYFREWLYNSLWFHKHH---------LWMTYESVVTG--------FFPFFLIATVIQLFYRG 405

  Fly   957 RIDNWTSF--HYNIVPILAFMFICFTCKSNIQLFVAQVLSTAYALIMMAVIVGTALQLGEDGIGS 1019
            ||.|...|  ...:|.|:...:.|| .:.|.::....:.|..|...::...:.....:.:.|.|:
  Rat   406 RIWNILLFLLTVQLVGIIKATYACF-LRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGT 469

  Fly  1020 --------------PSAIFLISMVGSF-FIAACLHPQEFWCITCGLIYLLSIPSMY-----LLLI 1064
                          |.:|::..::|.. :.|.|   |:.:..| .|.:|:|...:|     .||:
  Rat   470 SGRKTIVVNFIGLIPVSIWVAVLLGGLAYTAYC---QDLFSET-ELAFLVSGAILYGCYWVALLM 530

  Fly  1065 LYSIINLNVVSWGTREVVAKKTKKELEAEKKAAEE 1099
            ||..|            :|::..|:.|....|..|
  Rat   531 LYLAI------------IARRCGKKPEQYSLAFAE 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kkvNP_524233.1 Chitin_synth_C 583..904 CDD:133033 46/201 (23%)
Has3NP_758822.1 GT2_HAS 87..365 CDD:133056 46/201 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11041
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.