DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kar and out

DIOPT Version :9

Sequence 1:NP_001189213.1 Gene:kar / 45883 FlyBaseID:FBgn0001296 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001285435.1 Gene:out / 32926 FlyBaseID:FBgn0259834 Length:655 Species:Drosophila melanogaster


Alignment Length:240 Identity:63/240 - (26%)
Similarity:103/240 - (42%) Gaps:30/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DAMKPSAPVQNGNGNANGTHIEAPCCRDIHGKEPPDGGARAWLVMVSAFLCNGIIFGFINTYGVI 104
            |..||..|.:....:.....:            .|||| ..|:|.::|.|.|..:|..:..||:|
  Fly    17 DTTKPKKPKRRDKSDLGPDFV------------APDGG-WGWVVCLAAGLNNFFLFPALQQYGLI 68

  Fly   105 HSLLTDRLTKLGDPEASSKAALIGALAIGTTFLFSTMAGCLTDKIGLRLTTFAGGVLSAGGLLLS 169
            :.:   |:..||.....:...:...:||.:  |...:.|.:..:...|.....|..|:..|:.||
  Fly    69 YRV---RMQSLGFDAKQTTTIVNVVMAISS--LVGIVNGAMFRRFTFRQVALTGTSLAFLGVFLS 128

  Fly   170 SFCTENIGALYFTYGI----MFGLGAALAYTPTLAILGHYFKRYLGKVSGFVTAGSSVFTVILPP 230
            :|||     .::.|.|    :||:|..||...|...:..|||....:.:||....:.:..:..|.
  Fly   129 AFCT-----TFWQYIICLSAIFGIGLGLAMAATSLAVNTYFKLKRRRATGFSWTITGLGPIFFPQ 188

  Fly   231 CLDKLLGSYGLEGTLRIMSLVSAFIILCSFVYKPL--H-PPPEPP 272
            ....|||.||.:||:.|.:.::...|||:...:|:  | ..||.|
  Fly   189 VSTVLLGYYGAQGTILIYAGIAMNAILCALTLQPVLWHVKKPEKP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
karNP_001189213.1 MFS 81..459 CDD:119392 55/199 (28%)
MFS_1 124..439 CDD:284993 43/156 (28%)
outNP_001285435.1 MFS 45..>225 CDD:119392 51/189 (27%)
MFS <464..621 CDD:119392
MFS_1 468..>621 CDD:284993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.891027 Normalized mean entropy S3509
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.