DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kar and CG14196

DIOPT Version :9

Sequence 1:NP_001189213.1 Gene:kar / 45883 FlyBaseID:FBgn0001296 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_573367.1 Gene:CG14196 / 32915 FlyBaseID:FBgn0031002 Length:600 Species:Drosophila melanogaster


Alignment Length:230 Identity:59/230 - (25%)
Similarity:104/230 - (45%) Gaps:37/230 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PDGGARAWLVMVSAFLCNGIIFGFINTYGVIHSLLTDRLTKLGDPEASSKAALIGALAIGTTFLF 138
            ||.| .||:|.|:|.:.|..|:..:..:|.   |..:||:.||  .:||:...|    |......
  Fly    37 PDAG-WAWIVCVAAGVSNLSIYPCLQQFGF---LFRERLSDLG--MSSSQITAI----INANPAV 91

  Fly   139 STMAGCLTDKIGLRLT----TFAGGVLSAGGLLLSSFCTENIGALYFTYGIMFGLGAALAYTPTL 199
            |...|.|...:..|.|    ..||.:|.:|.|:|::|| |...:....|.::||.|..::.:.:.
  Fly    92 SACTGLLNGPMFRRFTFRQVAMAGSLLISGSLILTAFC-ETFLSYMVAYALLFGFGMGISVSASS 155

  Fly   200 AILGHYFKRYLGKVSGFVTAGSSVFTVILPPCLDKLLGSYGLEGTLRIMSLVSAFIILCSFVYKP 264
            ..:..||::...:.:||....:.:..:.||..:..||..||::||..:.:.:|....:|:.:|:|
  Fly   156 LAINTYFQKKRRRAAGFSWTITGLGPIFLPHLVTFLLTIYGVQGTTLLFAAISLHSFVCALIYQP 220

  Fly   265 LHPPPEPP----------------------KKKPG 277
            :....:||                      |::||
  Fly   221 VRYHVKPPVEQLADQEQQAEALCAHCSWQQKREPG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
karNP_001189213.1 MFS 81..459 CDD:119392 55/223 (25%)
MFS_1 124..439 CDD:284993 41/180 (23%)
CG14196NP_573367.1 MFS 71..>221 CDD:119392 40/156 (26%)
MFS <410..579 CDD:119392
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.891027 Normalized mean entropy S3509
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.