DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kar and LOC1273881

DIOPT Version :10

Sequence 1:NP_001189213.1 Gene:kar / 45883 FlyBaseID:FBgn0001296 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_061519623.1 Gene:LOC1273881 / 1273881 VectorBaseID:AGAMI1_005989 Length:850 Species:Anopheles gambiae


Alignment Length:94 Identity:21/94 - (22%)
Similarity:29/94 - (30%) Gaps:34/94 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 IPNRVETSFDK--------IADDYGTAYSKYDFE------------------------WANPGLE 149
            ||.:..|.::.        ..|||.|:..|..||                        | .|.:.
Mosquito    45 IPGKKSTPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDW-RPAIT 108

  Fly   150 IGYYVEHLLDVSNCDRIDKVICDTEAYPI 178
            |...:..:.|:.|...| |.....|||.|
Mosquito   109 IKQILLGIQDLLNEPNI-KDPAQAEAYTI 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
karNP_001189213.1 MFS_MCT8_10 80..474 CDD:340978 21/94 (22%)
LOC1273881XP_061519623.1 None

Return to query results.
Submit another query.