DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kar and slc16a5

DIOPT Version :9

Sequence 1:NP_001189213.1 Gene:kar / 45883 FlyBaseID:FBgn0001296 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_002940018.3 Gene:slc16a5 / 100485544 XenbaseID:XB-GENE-1008043 Length:455 Species:Xenopus tropicalis


Alignment Length:492 Identity:113/492 - (22%)
Similarity:206/492 - (41%) Gaps:69/492 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 EPPDGGARAWLVMVSAFLCNGIIFGFINTYGVIHSLLTDRLTKLGDPEASSKAALIGALAIGTTF 136
            |.|| |..||:|:.:..|..|:..||.:..|:.:   ||..|..  ..::::.:...::.:....
 Frog     2 ETPD-GPWAWVVLAAVMLTQGLSLGFPSCIGIFY---TDIQTSF--QASNTETSWFPSIIMAVLH 60

  Fly   137 LFSTMAGCLTDKIGLRLTTFAGGVLSAGGLLLSSFCTENIGALYFTYGIMFGLGAALAYTPTLAI 201
            ....:...:.::.|.|:|...||:|...|::.|:| ::.|..||.:.|.:.|||....:...:.:
 Frog    61 AGGPLCTIMVERFGCRVTVMVGGLLCGVGMVTSAF-SQTIIHLYLSAGFVGGLGFCFCFQAGITV 124

  Fly   202 LGHYFKRYLGKVSGFVTAGSSVFTVILPPCLDKLLGSYGLEGTLRIMSLVSAFIILCSFVYKP-- 264
            ||:||.|.....:...:||:|:...:.|.....||.:.|..|:..:...|.....:|..:.:|  
 Frog   125 LGYYFIRRRTLANSLASAGASIGMALWPLASQHLLETMGWRGSFLLFGGVLLNCCVCGAIMRPVR 189

  Fly   265 -LHP-------PPEPP---KKKPGRSRINLFLRSIINVE-IWKRKRFVIWALCVPLALFGYFVPY 317
             |.|       .||.|   |.|..::.....|:..:..: :::.:|:.|:||.|...:.|:.:|.
 Frog   190 SLEPAHEKEVLAPEEPNGIKHKGEKTEQGKGLQRYMAFDLLFRHRRYQIYALGVTWMVLGFVLPL 254

  Fly   318 VHMMQFVKTTFPGEDVN-----LPVMCIGITSGIGRLIFGVIADMPGVN--RMYLQQLSLVSIGL 375
            .:::.:..:    .|::     |.:..:|..:...|.:.|:::.....:  .|||..::::..||
 Frog   255 FYLVPYATS----NDIDEKKAALLLSLVGFMNIFMRPMAGLVSQQKVFHGRLMYLFSVAVILNGL 315

  Fly   376 VTLL------LPLTNSYVILVSFTLVMGLFDGCFI-SLLGPIAYEICGPSGATQAIGFLLGLSSI 433
            ..|:      .|...:|.:|.|.|:       .|| ||:..:..:..|......|.|....|.||
 Frog   316 SNLVCAIWVSFPALLTYCVLYSITM-------SFIGSLIFQVLMDTVGMKRFPGAFGLFTILESI 373

  Fly   434 PLTVGPPVAGMIFDSTNSYTLPLILAGLPPLLGSSLLFLIKCVKEEENGVSAPRAVVLANGDIEI 498
            .:..|||:||::.|.|..|.|....:.:  .:.||.||:                     |....
 Frog   374 TIMAGPPLAGLLVDITGQYGLVFYASSI--AVTSSGLFM---------------------GLASF 415

  Fly   499 AGNGHYRSAGTKSSAPLMGATNGINGSAPASPTIQSN 535
            |.:.....|...|..|.....|..||.|..||..|.:
 Frog   416 AVDRSEAKARRCSQRPTEATDNKDNGDAIYSPCKQED 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
karNP_001189213.1 MFS 81..459 CDD:119392 92/405 (23%)
MFS_1 124..439 CDD:284993 73/342 (21%)
slc16a5XP_002940018.3 MFS_MCT6 9..414 CDD:340983 98/444 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 1 1.000 - - FOG0000033
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.