DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ix and med29

DIOPT Version :9

Sequence 1:NP_610677.1 Gene:ix / 45881 FlyBaseID:FBgn0001276 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_775378.1 Gene:med29 / 797134 ZFINID:ZDB-GENE-021217-1 Length:179 Species:Danio rerio


Alignment Length:178 Identity:63/178 - (35%)
Similarity:91/178 - (51%) Gaps:16/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QMMQVMQSSPSGPPGPVQHQQQQPPQPLQQQQQAEKLDNISRVKSLLGPLRESM--FLTIRSSAF 76
            |.|....:..|.....|..|.|  .|.|.|||.   .|.:.|.|.|:.||::|:  .:||.|..|
Zfish     4 QQMSTNNAQMSAQQAAVLQQTQ--AQQLSQQQD---FDPVHRFKMLIPPLKDSLQNVMTIASLNF 63

  Fly    77 ALQQNNLADNLKRDTGAHH---VPRFDKHLEDFYACCDQIEIHLKTAMQCLQQQNSSNHYLPGPV 138
            |  .|...||..:.|...:   |.||||.||:|||.|||:|:.|:.|.:||.|...|..:.|..|
Zfish    64 A--HNTAIDNGLKTTEKGNDAAVQRFDKSLEEFYALCDQLELCLRLAHECLSQSIDSTKHSPNLV 126

  Fly   139 -TPMRMETFMPDNAGPISYPTYLNTVRVHIQSAKDIHDTLISAAQNIS 185
             |..:.:|...::   :||..||:.::..|..|||||:.|:..::.|:
Zfish   127 PTATKPDTVQTES---LSYSQYLSMIKSQISCAKDIHNALLECSKKIA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ixNP_610677.1 Med29 48..186 CDD:288425 52/144 (36%)
med29NP_775378.1 Med29 34..172 CDD:288425 52/146 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8480
eggNOG 1 0.900 - - E1_28J9T
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5144
OMA 1 1.010 - - QHG45671
OrthoDB 1 1.010 - - D1480686at2759
OrthoFinder 1 1.000 - - FOG0008041
OrthoInspector 1 1.000 - - oto40780
orthoMCL 1 0.900 - - OOG6_109450
Panther 1 1.100 - - LDO PTHR28314
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4650
SonicParanoid 1 1.000 - - X5997
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.