DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ix and Med29

DIOPT Version :9

Sequence 1:NP_610677.1 Gene:ix / 45881 FlyBaseID:FBgn0001276 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_080318.2 Gene:Med29 / 67224 MGIID:1914474 Length:199 Species:Mus musculus


Alignment Length:194 Identity:69/194 - (35%)
Similarity:97/194 - (50%) Gaps:27/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MSGPQMMQVMQSSPS--------GPPGPVQHQQQQPPQPLQ---------QQQQAEKLDNISRVK 57
            |:.||......||.|        |.|||     ||.|||.|         .|||.:..|.:.|.|
Mouse     1 MAAPQPQAAAVSSASGVSGPGSAGGPGP-----QQQPQPTQLVGSAQSGLLQQQQQDFDPVQRYK 60

  Fly    58 SLLGPLRESMFLTIRSSAFALQQNNLADNLKRDTGAHHVPRFDKHLEDFYACCDQIEIHLKTAMQ 122
            .|:..|:||:...::.:|..|.||...||.::.:.| .:.||||.||:|||.|||:|:.|:.|.:
Mouse    61 MLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDA-PLQRFDKCLEEFYALCDQLELCLRLAHE 124

  Fly   123 CLQQQNSSNHYLPGPV-TPMRMETFMPDNAGPISYPTYLNTVRVHIQSAKDIHDTLISAAQNIS 185
            ||.|...|..:.|..| |..:.:...||:   :.||.||..::..|..|||||..|:..|..::
Mouse   125 CLSQSCDSAKHSPTLVPTATKPDAVQPDS---LPYPQYLAVIKAQITCAKDIHTALLDCANKVT 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ixNP_610677.1 Med29 48..186 CDD:288425 50/139 (36%)
Med29NP_080318.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 16/50 (32%)
Med29 52..186 CDD:314458 50/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8281
eggNOG 1 0.900 - - E1_28J9T
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4978
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45671
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008041
OrthoInspector 1 1.000 - - oto92480
orthoMCL 1 0.900 - - OOG6_109450
Panther 1 1.100 - - LDO PTHR28314
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4650
SonicParanoid 1 1.000 - - X5997
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.