DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ix and Med29

DIOPT Version :9

Sequence 1:NP_610677.1 Gene:ix / 45881 FlyBaseID:FBgn0001276 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001099707.1 Gene:Med29 / 292751 RGDID:1311009 Length:199 Species:Rattus norvegicus


Alignment Length:194 Identity:69/194 - (35%)
Similarity:97/194 - (50%) Gaps:27/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MSGPQMMQVMQSSP---SGP-----PGPVQHQQQQPPQPLQ---------QQQQAEKLDNISRVK 57
            |:.||......||.   |||     |||     ||.|||.|         .|||.:..|.:.|.|
  Rat     1 MAAPQPQAAAVSSAAGVSGPGSAGGPGP-----QQQPQPTQLVGAAQSGLLQQQQQDFDPVQRYK 60

  Fly    58 SLLGPLRESMFLTIRSSAFALQQNNLADNLKRDTGAHHVPRFDKHLEDFYACCDQIEIHLKTAMQ 122
            .|:..|:||:...::.:|..|.||...||.::.:.. .:.||||.||:|||.|||:|:.|:.|.:
  Rat    61 MLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDG-PIQRFDKCLEEFYALCDQLELCLRLAHE 124

  Fly   123 CLQQQNSSNHYLPGPV-TPMRMETFMPDNAGPISYPTYLNTVRVHIQSAKDIHDTLISAAQNIS 185
            ||.|...|..:.|..| |..:.:...||:   :.||.||..::..|..|||||..|:..|..::
  Rat   125 CLSQSCDSAKHSPTLVPTATKPDAVQPDS---LPYPQYLAVIKAQITCAKDIHTALLDCANKVT 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ixNP_610677.1 Med29 48..186 CDD:288425 49/139 (35%)
Med29NP_001099707.1 Med29 52..186 CDD:288425 49/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8200
eggNOG 1 0.900 - - E1_28J9T
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I4930
OMA 1 1.010 - - QHG45671
OrthoDB 1 1.010 - - D1480686at2759
OrthoFinder 1 1.000 - - FOG0008041
OrthoInspector 1 1.000 - - oto96045
orthoMCL 1 0.900 - - OOG6_109450
Panther 1 1.100 - - LDO PTHR28314
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5997
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.