DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldh and UEVLD

DIOPT Version :9

Sequence 1:NP_001261474.1 Gene:Ldh / 45880 FlyBaseID:FBgn0001258 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001035787.1 Gene:UEVLD / 55293 HGNCID:30866 Length:471 Species:Homo sapiens


Alignment Length:340 Identity:116/340 - (34%)
Similarity:184/340 - (54%) Gaps:40/340 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLAQVAEVLPS---------SGH------KVTIVGIGQVGMASAFSILAQNVSKEVCLIDVCADK 57
            |||.:|::...         :.|      |:|:||.|::|:|...:|.|:.::..:.|:|: ::.
Human   155 LLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRLVLLDL-SEG 218

  Fly    58 LQGELMDLQHGSNFLKNPQITASTDFAASANSRLCIVTAGVRQKEGESRLSLVQRNTDILKNIIP 122
            .:|..|||:    ....|.:..|.|.:|||:|::.|.|.. .....:|.|.:||.|.|:.:.::|
Human   219 TKGATMDLE----IFNLPNVEISKDLSASAHSKVVIFTVN-SLGSSQSYLDVVQSNVDMFRALVP 278

  Fly   123 KLVEYSPDTILLMVSNPVDIMTYVAWKLSGLPKNRVIGSGTNLDSSRFRFLMSQRLGVAPTSCHG 187
            .|..||..::||:.|.||:|||||.||||..|.|||||.|.||||.|.:::::..|....:....
Human   279 ALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEV 343

  Fly   188 WIIGEHGDSSVPVWSGVNIAGVRLRELNPILGTGEDPEKWNELHKQVVDSAYEVIKLKGYTSWAI 252
            |:|||.|:..|..||                  |::....:....|:.:.|.|::::||..||::
Human   344 WVIGEQGEDKVLTWS------------------GQEEVVSHTSQVQLSNRAMELLRVKGQRSWSV 390

  Fly   253 GLSTASLASAILRNTSSVAAVSTSVLGEHGIDKDVFLSLPCVLNANGVTSVVKQIL-TPTEVEQL 316
            |||.|.:..:|:.|...|.:||....|.:.|:.:|||||||:|..|||:.|:|..| ..|..|:|
Human   391 GLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKL 455

  Fly   317 QKSANIMSDVQAGLK 331
            |.||:.:..:|..||
Human   456 QSSASSIHSLQQQLK 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LdhNP_001261474.1 LDH_1 18..329 CDD:133429 110/326 (34%)
UEVLDNP_001035787.1 UEV 21..138 CDD:283415
PLN02602 161..471 CDD:178212 112/334 (34%)
LDH_1 180..468 CDD:133429 109/311 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.