DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldh and Mdh1

DIOPT Version :9

Sequence 1:NP_001261474.1 Gene:Ldh / 45880 FlyBaseID:FBgn0001258 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001303806.1 Gene:Mdh1 / 24551 RGDID:3072 Length:355 Species:Rattus norvegicus


Alignment Length:329 Identity:81/329 - (24%)
Similarity:139/329 - (42%) Gaps:37/329 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KVTIVG-IGQVGMASAFSILAQNV-SKEVCLIDVCAD------KLQGELMDLQHGSNFLKNPQIT 78
            :|.:.| .||:..:..:||...:| .|:..:|.|..|      .|.|.||:||..:..|....|.
  Rat     6 RVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIA 70

  Fly    79 ASTDFAASANSRLCIVTAGVRQKEGESRLSLVQRNTDILKNIIPKLVEYSPDTI-LLMVSNPVDI 142
            ...:..|..:..:.::...:.::||..|..|::.|..|.|:....|.:|:..:: :::|.||.:.
  Rat    71 TDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYAKKSVKVIVVGNPANT 135

  Fly   143 MTYVAWKLS-GLPKNRVIGSGTNLDSSRFRFLMSQRLGVAPTSCHGWII-GEHGDSSVPVWSGVN 205
            ....|.|.: .:||.. ....|.||.:|.:..::.:|||........|| |.|..:..|   .||
  Rat   136 NCLTASKSAPSIPKEN-FSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYP---DVN 196

  Fly   206 IAGVRL--RELNPILGTGEDPEKWNELHKQVVDSAYEVIKLKGYTSWAIGLSTASLASAILRN-- 266
            .|.|:|  :|:.......:|.....|....|......|||.:..:|   .:|.|...|..:|:  
  Rat   197 HAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSS---AMSAAKAISDHIRDIW 258

  Fly   267 --TSSVAAVSTSVLGE---HGIDKDVFLSLPCVLN------ANGVT----SVVKQILTPTEVEQL 316
              |.....||..|:.:   :|:..|:..|.|.|:.      ..|:.    |..|..||..|:.:.
  Rat   259 FGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEE 323

  Fly   317 QKSA 320
            :::|
  Rat   324 KETA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LdhNP_001261474.1 LDH_1 18..329 CDD:133429 81/329 (25%)
Mdh1NP_001303806.1 MalateDH-SF1 2..327 CDD:130820 80/327 (24%)
MDH_cytoplasmic_cytosolic 3..328 CDD:133421 81/329 (25%)
PTS1 353..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.