DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ImpE1 and DGCR2

DIOPT Version :9

Sequence 1:	NP_001261577.1	Gene:	ImpE1 / 45879	FlyBaseID:	FBgn0001253	Length:	1616	Species:	Drosophila melanogaster
Sequence 2:	NP_005128.1	Gene:	DGCR2 / 9993	HGNCID:	2845	Length:	550	Species:	Homo sapiens

Alignment Length:	127	Identity:	33/127 - (25%)
Similarity:	46/127 - (36%)	Gaps:	40/127 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly  1404 CSPGTFQCRSSGV-CISWFFVCDGRADCNDASDEECTHNARLNQTCPTESFRCQRSGRCISRAAL 1467
            |:||.|.|||..: ||...:.|||.|.|.|.|||         ..||..:
Human    30 CNPGQFACRSGTIQCIPLPWQCDGWATCEDESDE---------ANCPEVT--------------- 70

  Fly  1468 CDGRRQCPHGEDELG-CDGSVKGGNACPEH----------TFRCGSGECLPEYEYCNAIVSC 1518
              |..:..||::.:. ..|..:||:  |.|          .|....|:|...:.:.....||
Human    71 --GEVRPHHGKEAVDPRQGRARGGD--PSHFHAVNVAQPVRFSSFLGKCPTGWHHYEGTASC 128

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ImpE1	NP_001261577.1	EB	75..131	CDD:279949
		LDLa	1404..1437	CDD:238060	17/33 (52%)
		LDLa	1448..1483	CDD:238060	5/35 (14%)
		LDLa	1493..1524	CDD:238060	7/36 (19%)
		LDLa	1561..1590	CDD:238060
DGCR2	NP_005128.1	LDLa	30..66	CDD:238060	18/44 (41%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	69..92		4/39 (10%)
		CLECT_DGCR2_like	115..267	CDD:153069	3/14 (21%)
		VWC	271..329	CDD:214564
		Atrophin-1	<428..537	CDD:331285
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	500..550
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1215
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900