| Sequence 1: | NP_001261577.1 | Gene: | ImpE1 / 45879 | FlyBaseID: | FBgn0001253 | Length: | 1616 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038948896.1 | Gene: | Lrp3 / 89787 | RGDID: | 619729 | Length: | 810 | Species: | Rattus norvegicus |
| Alignment Length: | 451 | Identity: | 98/451 - (21%) |
|---|---|---|---|
| Similarity: | 118/451 - (26%) | Gaps: | 230/451 - (50%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1304 LMEPAAPVVTTLMPLMTADEPTPEP--VSPAAIPSASLAAIKPGTELRKRVDLGL--EAVSLGLA 1364
Fly 1365 ----------------CSSDR-------------QCQLADPHTVCNRRGVCDCAAGEEGSQCSA- 1399
Fly 1400 --ERTG--CSPGTFQCRSSGV----CISWFFVCDGRADCNDASDE-------------------- 1436
Fly 1437 --------------ECT---------------------------------HNARLNQTCPTES-- 1452
Fly 1453 -----------------FRCQRSGR----------------------------------CISRAA 1466
Fly 1467 LCDGRRQCPHGEDELGCDGSVKGGNACPEHTFRC--GSGECLPEYEYCNAIVSCKDGSDEPPHLC 1529
Fly 1530 GSRALPNLFMRLIEAGGLLGGGRREADAYCPHRCSNGLCRSTAIVCSGRDGCGDGTDEQTC 1590 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ImpE1 | NP_001261577.1 | EB | 75..131 | CDD:279949 | |
| LDLa | 1404..1437 | CDD:238060 | 17/70 (24%) | ||
| LDLa | 1448..1483 | CDD:238060 | 12/87 (14%) | ||
| LDLa | 1493..1524 | CDD:238060 | 13/32 (41%) | ||
| LDLa | 1561..1590 | CDD:238060 | 10/28 (36%) | ||
| Lrp3 | XP_038948896.1 | CUB | 43..156 | CDD:238001 | 18/70 (26%) |
| LDLa | 166..200 | CDD:238060 | 7/44 (16%) | ||
| LDLa | 212..249 | CDD:238060 | 17/38 (45%) | ||
| CUB | 254..364 | CDD:238001 | 9/109 (8%) | ||
| LDLa | 416..452 | CDD:238060 | 15/37 (41%) | ||
| LDLa | 455..489 | CDD:238060 | 12/56 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||