DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpE1 and si:dkey-258f14.3

DIOPT Version :9

Sequence 1:NP_001261577.1 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster
Sequence 2:XP_021334056.1 Gene:si:dkey-258f14.3 / 571152 ZFINID:ZDB-GENE-050809-43 Length:526 Species:Danio rerio


Alignment Length:235 Identity:66/235 - (28%)
Similarity:92/235 - (39%) Gaps:66/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1361 LGLACSSDRQCQLADPHTVCNRRGVCDCAAGEEGSQCSAERTGCSPGTFQCRSSGVCISWFFVCD 1425
            |...|::.|...|:   :.|:  .|.||..|.:...|    ..|:.|:|.|.:|..|:|...|||
Zfish    41 LQFVCANSRCVSLS---SRCD--AVNDCGDGSDEISC----WNCTNGSFHCVASESCVSSSSVCD 96

  Fly  1426 GRADCNDASDEE---CTHNARLNQTCPTESFRCQRSGRCISRAALCDGRRQCPHGEDELGCDG-- 1485
            ||.||.|.:||:   ||..::. |.|....|.| .:|:|:..:..||....|..|.||..||.  
Zfish    97 GRPDCADGADEQLDTCTSFSQA-QPCARSEFTC-TNGQCVPNSWRCDHSSDCKDGSDEEDCDHNE 159

  Fly  1486 -SVKGGNACPEHT-------FRCG--SGECLPEYEYCNAIVSCKDGSDEPPHLCGSRALPNLFMR 1540
             :|..|..  .||       |||.  .|..|.:..:|..:..|.|..     :|           
Zfish   160 CAVNNGGC--SHTCIDLPFGFRCDCPKGMRLVQDTHCEVVDQCLDAD-----VC----------- 206

  Fly  1541 LIEAGGLLGGGRREADAYCPHRCSNGLCRSTAIVCSGRDG 1580
                           |..|.|  |||     ::||..:||
Zfish   207 ---------------DQICVH--SNG-----SVVCDCQDG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpE1NP_001261577.1 EB 75..131 CDD:279949
LDLa 1404..1437 CDD:238060 16/32 (50%)
LDLa 1448..1483 CDD:238060 11/34 (32%)
LDLa 1493..1524 CDD:238060 10/39 (26%)
LDLa 1561..1590 CDD:238060 8/20 (40%)
si:dkey-258f14.3XP_021334056.1 LDLa 38..72 CDD:238060 9/35 (26%)
PRKCSH-like <45..>112 CDD:193472 26/75 (35%)
LDLa 121..155 CDD:238060 11/34 (32%)
FXa_inhibition 160..193 CDD:317114 9/34 (26%)
Ldl_recept_b 367..407 CDD:278487
LY 393..433 CDD:214531
LY 434..476 CDD:214531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.