DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpE1 and Cd320

DIOPT Version :9

Sequence 1:NP_001261577.1 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster
Sequence 2:NP_062294.3 Gene:Cd320 / 54219 MGIID:1860083 Length:260 Species:Mus musculus


Alignment Length:135 Identity:46/135 - (34%)
Similarity:59/135 - (43%) Gaps:22/135 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1396 QCSAERT-GCSPGTFQCRSSGVCISWFFVCDGRADCNDASDEECTHNARLNQTCPTESFRCQRSG 1459
            |.|..|. .|...||||.:||.|:...:.|||..||:|.||||         .|..||  |.::|
Mouse    38 QVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEE---------DCRIES--CAQNG 91

  Fly  1460 RCISRAAL---CDGRRQCPHGEDE-LGCDGSVKGGNACPEHTFRCGSGE-CLPEYEYCNAIVSCK 1519
            :|..::||   ||....|....|: |.|...     .|.|....|...: |:|....|:....|.
Mouse    92 QCQPQSALPCSCDNISGCSDVSDKNLNCSRP-----PCQESELHCILDDVCIPHTWRCDGHPDCL 151

  Fly  1520 DGSDE 1524
            |.|||
Mouse   152 DSSDE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpE1NP_001261577.1 EB 75..131 CDD:279949
LDLa 1404..1437 CDD:238060 16/32 (50%)
LDLa 1448..1483 CDD:238060 13/38 (34%)
LDLa 1493..1524 CDD:238060 9/31 (29%)
LDLa 1561..1590 CDD:238060
Cd320NP_062294.3 LDLa 47..82 CDD:238060 18/43 (42%)
LDLa 124..159 CDD:238060 11/33 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.