DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ImpE1 and LRP1B

DIOPT Version :9

Sequence 1:	NP_001261577.1	Gene:	ImpE1 / 45879	FlyBaseID:	FBgn0001253	Length:	1616	Species:	Drosophila melanogaster
Sequence 2:	NP_061027.2	Gene:	LRP1B / 53353	HGNCID:	6693	Length:	4599	Species:	Homo sapiens

Alignment Length:	303	Identity:	87/303 - (28%)
Similarity:	117/303 - (38%)	Gaps:	69/303 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly  1354 LGLEAVSLGLACSSDRQCQLADPHTVCNRRGVCDCAAGEEGSQCSAE-RTGCSPGTFQCRSSGVC 1417
            ||::.... :.|:|...|.|  |..:|:  |..||....:..:|..: :..|....|.| .||.|
Human  2636 LGVKTTGF-IRCNSTSLCVL--PTWICD--GSNDCGDYSDELKCPVQNKHKCEENYFSC-PSGRC 2694

  Fly  1418 ISWFFVCDGRADCNDASDE-ECTHNARLNQ----------------------------------- 1446
            |...::|||:.||.|..|| .|..:...||
Human  2695 ILNTWICDGQKDCEDGRDEFHCDSSCSWNQFACSAQKCISKHWICDGEDDCGDGLDESDSICGAI 2759

  Fly  1447 TCPTESFRCQRSGRCISRAALCDGRRQCPHGEDELGCDGSVKGGNACPEHTFRCGSGECLPEYEY 1511
            ||..:.|.||.|..|:.|..||||.|.||.|.|||...|... .|.|.|:.|.|.:..|:|:...
Human  2760 TCAADMFSCQGSRACVPRHWLCDGERDCPDGSDELSTAGCAP-NNTCDENAFMCHNKVCIPKQFV 2823

  Fly  1512 CNAIVSCKDGSDEPPHLCGSRALPNLFMRLIEAGGLLG-GGRREADAYCPHR------------- 1562
            |:....|.|||||.|. ||.|..........:...||. ..:.:.|..||..
Human  2824 CDHDDDCGDGSDESPQ-CGYRQCGTEEFSCADGRCLLNTQWQCDGDFDCPDHSDEAPLNPKCKSA 2887

  Fly  1563 ----------CSNGLCRSTAIVCSGRDGCGDGTDEQTCSVCRC 1595
                      |.||.|..:..:|..:|.||||:||:.|.:..|
Human  2888 EQSCNSSFFMCKNGRCIPSGGLCDNKDDCGDGSDERNCHINEC 2930

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ImpE1	NP_001261577.1	EB	75..131	CDD:279949
		LDLa	1404..1437	CDD:238060	15/33 (45%)
		LDLa	1448..1483	CDD:238060	18/34 (53%)
		LDLa	1493..1524	CDD:238060	11/30 (37%)
		LDLa	1561..1590	CDD:238060	12/51 (24%)
LRP1B	NP_061027.2	FXa_inhibition	165..193	CDD:291342
		NHL	282..459	CDD:302697
		NHL repeat	285..321	CDD:271320
		LDL-receptor class B 1	295..337
		LY	319..361	CDD:214531
		NHL repeat	328..367	CDD:271320
		LDL-receptor class B 2	338..381
		NHL repeat	371..406	CDD:271320
		LDL-receptor class B 3	382..425
		NHL repeat	415..445	CDD:271320
		FXa_inhibition	483..516	CDD:291342
		LY	548..590	CDD:214531
		LDL-receptor class B 4	568..610
		LY	591..630	CDD:214531
		LDL-receptor class B 5	611..656
		LY	637..686	CDD:214531
		LDL-receptor class B 6	657..706
		LY	687..729	CDD:214531
		LDL-receptor class B 7	707..750
		FXa_inhibition	798..833	CDD:291342
		LDLa	886..919	CDD:238060
		LDLa	926..958	CDD:197566
		LDLa	1006..1038	CDD:238060
		LDLa	1053..1088	CDD:238060
		LDLa	1097..1131	CDD:238060
		LDLa	1136..1169	CDD:238060
		FXa_inhibition	1176..1212	CDD:291342
		LY	1280..1318	CDD:214531
		LDL-receptor class B 8	1300..1346
		LY	1327..1367	CDD:214531
		LDL-receptor class B 9	1347..1389
		LY	1371..1414	CDD:214531
		LDL-receptor class B 10	1390..1436
		LY	<1426..1458	CDD:214531
		LDL-receptor class B 11	1437..1480
		LDL-receptor class B 12	1481..1522
		LDL-receptor class B 13	1618..1660
		Ldl_recept_b	1618..1657	CDD:278487
		LY	1641..1683	CDD:214531
		LDL-receptor class B 14	1661..1704
		LY	1685..1724	CDD:214531
		LDL-receptor class B 15	1705..1744
		LY	<1735..1766	CDD:214531
		LDL-receptor class B 16	1745..1787
		FXa_inhibition	1838..1874	CDD:291342
		NHL	1913..2138	CDD:302697
		NHL repeat	1913..1952	CDD:271320
		LDL-receptor class B 17	1922..1964
		LY	1947..1987	CDD:214531
		NHL repeat	1957..1994	CDD:271320
		LDL-receptor class B 28	1965..2007
		NHL repeat	1998..2036	CDD:271320
		LDL-receptor class B 19	2008..2051
		Ldl_recept_b	2008..2048	CDD:278487
		LY	2033..2075	CDD:214531
		NHL repeat	2042..2080	CDD:271320
		LDL-receptor class B 20	2052..2095
		NHL repeat	2089..2128	CDD:271320
		FXa_inhibition	2147..2182	CDD:291342
		LDL-receptor class B 21	2239..2280
		LDL-receptor class B 22	2281..2329
		LDL-receptor class B 23	2330..2374
		Ldl_recept_b	2330..2371	CDD:278487
		LY	2355..2397	CDD:214531
LDL-receptor class B 24	2375..2416
LDL-receptor class B 25	2417..2459
LDLa	2514..2543	CDD:238060
LDLa	2552..2586	CDD:238060
LDLa	2591..2625	CDD:238060
LDLa	2682..2716	CDD:238060	15/34 (44%)
LDLa	2720..2753	CDD:238060	2/32 (6%)
LDLa	2760..2793	CDD:197566	16/32 (50%)
LDLa	2844..2877	CDD:197566	5/32 (16%)
LDLa	2891..2925	CDD:238060	12/33 (36%)
cEGF	2948..2971	CDD:289433
EGF_CA	2968..2998	CDD:214542
LY	3035..3079	CDD:214531
LDL-receptor class B 26	3055..3098
LY	3080..3118	CDD:214531
LDL-receptor class B 27	3099..3141
LY	3123..3164	CDD:214531
LDL-receptor class B 28	3142..3185
LY	3167..3206	CDD:214531
LDL-receptor class B 29	3186..3224
LDL-receptor class B 30	3225..3268
FXa_inhibition	3277..3313	CDD:291342
LDLa	3317..3348	CDD:197566
LDLa	3357..3391	CDD:238060
LDLa	3396..3431	CDD:238060
LDLa	3436..3471	CDD:238060
LDLa	3476..3510	CDD:238060
LDLa	3515..3549	CDD:238060
LDLa	3553..3587	CDD:238060
LDLa	3594..3628	CDD:238060
LDLa	3632..3667	CDD:238060
LDLa	3674..3706	CDD:238060
LDLa	3721..3751	CDD:238060
LDLa	3762..3796	CDD:238060
EGF_CA	3844..3878	CDD:214542
LDL-receptor class B 31	3933..3980
LDL-receptor class B 32	3981..4038
LDL-receptor class B 33	4039..4082
Ldl_recept_b	4039..4079	CDD:278487
LY	4063..4102	CDD:214531
LDL-receptor class B 34	4083..4127
Endocytosis signal. /evidence=ECO:0000255	4492..4495
Endocytosis signal. /evidence=ECO:0000255	4559..4562
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1215
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900