Sequence 1: | NP_001261577.1 | Gene: | ImpE1 / 45879 | FlyBaseID: | FBgn0001253 | Length: | 1616 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005157607.1 | Gene: | sorl1 / 497306 | ZFINID: | ZDB-GENE-050208-22 | Length: | 2213 | Species: | Danio rerio |
Alignment Length: | 339 | Identity: | 95/339 - (28%) |
---|---|---|---|
Similarity: | 122/339 - (35%) | Gaps: | 111/339 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 1321 ADEP-----TPEP------VSPAAIPSASLAAIKPGTELRKRVDLGLEAVSLGLACSSDRQCQ-- 1372
Fly 1373 -----------------LADPHTVCNRRGVC-----------DCAAGEEGSQCSAERTGCSPGT- 1408
Fly 1409 FQCRSSGVCISWFFVCDGRADCNDASDEE-CTHNARLNQTCPTESFRCQRSGRCISRAALCDGRR 1472
Fly 1473 QCPHGEDELGCDGSVKGGNACPEHTFRCGSGECLPEYEYCNAIVSCKDGSDEPPHLCGSRALPNL 1537
Fly 1538 FMRLIEAGGLLGGGRREADAYCPHRCSNGLCRSTAIVCSGRDGCGDGTDEQTCSVCRCPAPTAAS 1602
Fly 1603 LPAFLARQRPMPLW 1616 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpE1 | NP_001261577.1 | EB | 75..131 | CDD:279949 | |
LDLa | 1404..1437 | CDD:238060 | 16/33 (48%) | ||
LDLa | 1448..1483 | CDD:238060 | 14/34 (41%) | ||
LDLa | 1493..1524 | CDD:238060 | 11/30 (37%) | ||
LDLa | 1561..1590 | CDD:238060 | 12/28 (43%) | ||
sorl1 | XP_005157607.1 | VPS10 | 130..754 | CDD:214740 | |
Sortilin_C | 589..754 | CDD:292523 | |||
LY | 781..822 | CDD:214531 | |||
LY | 825..864 | CDD:214531 | |||
LY | 868..912 | CDD:214531 | |||
LY | 916..954 | CDD:214531 | |||
LDLa | 1079..1113 | CDD:238060 | 7/35 (20%) | ||
LDLa | 1118..1154 | CDD:238060 | 18/35 (51%) | ||
LDLa | 1159..1193 | CDD:238060 | 14/34 (41%) | ||
LDLa | 1242..1273 | CDD:238060 | 14/44 (32%) | ||
LDLa | 1282..1310 | CDD:197566 | 4/12 (33%) | ||
LDLa | 1327..1361 | CDD:238060 | |||
LDLa | 1376..1405 | CDD:238060 | |||
LDLa | 1421..1455 | CDD:238060 | |||
LDLa | 1474..1509 | CDD:238060 | |||
LDLa | 1522..1551 | CDD:238060 | |||
FN3 | 1559..>1630 | CDD:238020 | |||
FN3 | 1653..1743 | CDD:238020 | |||
FN3 | 1750..1827 | CDD:238020 | |||
FN3 | 1931..2007 | CDD:238020 | |||
FN3 | 2022..2097 | CDD:214495 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |