DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpE1 and LRP4

DIOPT Version :10

Sequence 1:NP_524849.2 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster
Sequence 2:NP_002325.2 Gene:LRP4 / 4038 HGNCID:6696 Length:1905 Species:Homo sapiens


Alignment Length:282 Identity:87/282 - (30%)
Similarity:112/282 - (39%) Gaps:57/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1354 LGLEAVSLGLACSSDRQCQLADPHTVC--NRRGVCDCAAGEEGSQCSAER-------------TG 1403
            ||....:.|||  |..:|.....|..|  :..|.|.|...:  .||..:.             ..
Human    10 LGALLCAHGLA--SSPECACGRSHFTCAVSALGECTCIPAQ--WQCDGDNDCGDHSDEDGCILPT 70

  Fly  1404 CSPGTFQCRSSGVCISWFFVCDGRADCNDASDE-ECTHNARLNQTCPTESFRCQRSGRCISRAAL 1467
            |||..|.| .:|.||...:||||..||.|.||| :|.     .:.|..:.|.|| :|.||.....
Human    71 CSPLDFHC-DNGKCIRRSWVCDGDNDCEDDSDEQDCP-----PRECEEDEFPCQ-NGYCIRSLWH 128

  Fly  1468 CDGRRQCPHGEDELGCDGSVKGGNACPEHTFRCGSGECLPEYEYCNAIVSCKDGSDE-------- 1524
            |||...|....|| .||     ...|.:..|||..|.|:.|:.||:....|||||||        
Human   129 CDGDNDCGDNSDE-QCD-----MRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEENCPSAVP 187

  Fly  1525 -PPHLCGSRALPNLFMRLI------EAGGLLGGGRREAD--AYCPHR-----CSNGLCRSTAIVC 1575
             ||  |........:.|.|      :.....|....|:|  ::.|.|     |.:|||.:....|
Human   188 APP--CNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRC 250

  Fly  1576 SGRDGCGDGTDEQTCSVCRCPA 1597
            .|...|.|.:||:.|:...|.|
Human   251 DGDADCDDQSDERNCTTSMCTA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpE1NP_524849.2 EB 75..131 CDD:460294
rne <795..981 CDD:236766
LDLa 1404..1437 CDD:238060 18/33 (55%)
LDLa 1448..1483 CDD:238060 13/34 (38%)
LDLa 1493..1524 CDD:238060 14/30 (47%)
LRP4NP_002325.2 LDLa 27..66 CDD:238060 7/40 (18%)
Ldl_recept_a 70..105 CDD:395011 18/35 (51%)
LDLa 110..142 CDD:238060 13/33 (39%)
LDLa 148..182 CDD:238060 16/33 (48%)
LDLa 231..265 CDD:238060 11/33 (33%)
LDLa 270..304 CDD:238060 2/3 (67%)
LDLa 311..343 CDD:197566
FXa_inhibition 358..393 CDD:464251
EGF_CA 395..434 CDD:214542
LY 460..502 CDD:214531
LDL-receptor class B 1 480..522
LY 505..545 CDD:214531
LDL-receptor class B 2 523..565
LDL-receptor class B 3 566..609
Ldl_recept_b 566..607 CDD:459654
LY 590..632 CDD:214531
LDL-receptor class B 4 610..652
LY 633..673 CDD:214531
LDL-receptor class B 5 653..693
FXa_inhibition 702..>729 CDD:464251
YncE 749..982 CDD:442618
LDL-receptor class B 6 785..827
LY 808..850 CDD:214531
LDL-receptor class B 7 828..870
LDL-receptor class B 8 871..914
Ldl_recept_b 871..912 CDD:459654
LY 895..937 CDD:214531
LDL-receptor class B 9 915..956
LDL-receptor class B 10 957..998
FXa_inhibition 1006..1043 CDD:464251
NHL <1085..1277 CDD:302697
NHL repeat 1085..1123 CDD:271320
LDL-receptor class B 11 1093..1135
NHL repeat 1128..1161 CDD:271320
LDL-receptor class B 12 1136..1178
NHL repeat 1166..1203 CDD:271320
LDL-receptor class B 13 1179..1222
Ldl_recept_b 1179..1219 CDD:459654
NHL repeat 1212..1244 CDD:271320
LDL-receptor class B 14 1223..1263
NHL repeat 1253..1277 CDD:271320
LDL-receptor class B 15 1264..1306
FXa_inhibition 1313..1348 CDD:464251
Vgb 1332..1583 CDD:443399
LDL-receptor class B 16 1397..1439
LDL-receptor class B 17 1440..1482
LDL-receptor class B 18 1483..1526
LDL-receptor class B 19 1527..1568
LDL-receptor class B 20 1569..1610
FXa_inhibition 1617..1648 CDD:464251
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1659..1686
Endocytosis signal. /evidence=ECO:0000255 1766..1769
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1852..1905
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.