DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpE1 and LRP3

DIOPT Version :9

Sequence 1:NP_001261577.1 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster
Sequence 2:XP_005259002.1 Gene:LRP3 / 4037 HGNCID:6695 Length:785 Species:Homo sapiens


Alignment Length:443 Identity:101/443 - (22%)
Similarity:121/443 - (27%) Gaps:214/443 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly  1304 LMEPAAPVVTTLMPLMTADEPTPEP--VSPAAIPSASLAAIKPGTELRKRVDLGL--EAVSLGLA 1364
            |:.||||             |..|.  :..:|||.|.::|       |..|.:..  :|.|.|.|
Human   105 LLGPAAP-------------PRQEAFRLCGSAIPPAFISA-------RDHVWIFFHSDASSSGQA 149

  Fly  1365 ----------------CSSDR-QCQ----LADPHTVCNRRGVCDCAAGEEGSQCSA---ERTG-- 1403
                            |.:|. :|.    |..|.. ||.  |.:|..|.:...|||   |..|  
Human   150 QGFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQ-CNT--VDECGDGSDEGNCSAPASEPPGSL 211

  Fly  1404 CSPGTFQCRSSGV----CISWFFVCDGRADCNDASDE---------------------------- 1436
            |..|||.|  ||.    |:.....|||..||.|.|||                            
Human   212 CPGGTFPC--SGARSTRCLPVERRCDGLQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAA 274

  Fly  1437 ------ECT---------------------------------HNARLNQTCPTES---------- 1452
                  .||                                 ...||.||....|          
Human   275 RGPSDLHCTWLVDTQDSRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAA 339

  Fly  1453 ---------FRCQRSGR----------------------------------CISRAALCDGRRQC 1474
                     .|.:.:|.                                  |.|....|||...|
Human   340 QGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSDSDGGSLGDQGCFSEPQRCDGWWHC 404

  Fly  1475 PHGEDELGCDGSVKGGNACPEHTFRC--GSGECLPEYEYCNAIVSCKDGSDEPPHLCGSRALPNL 1537
            ..|.||.||.       |||...:.|  |||.|....:.||...||.||:||..  |.| ..|..
Human   405 ASGRDEQGCP-------ACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKN--CFS-CQPGT 459

  Fly  1538 FMRLIEAGGLLGGGRREADAYCPHRCSNGLCRSTAIVCSGRDGCGDGTDEQTC 1590
            |                       .|...||......|.|::.|.||:||..|
Human   460 F-----------------------HCGTNLCIFETWRCDGQEDCQDGSDEHGC 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpE1NP_001261577.1 EB 75..131 CDD:279949
LDLa 1404..1437 CDD:238060 17/70 (24%)
LDLa 1448..1483 CDD:238060 12/87 (14%)
LDLa 1493..1524 CDD:238060 13/32 (41%)
LDLa 1561..1590 CDD:238060 10/28 (36%)
LRP3XP_005259002.1 CUB 43..156 CDD:238001 18/70 (26%)
LDLa 166..200 CDD:238060 10/36 (28%)
LDLa 212..249 CDD:238060 17/38 (45%)
CUB 254..364 CDD:238001 9/109 (8%)
LDLa 416..452 CDD:238060 15/37 (41%)
LDLa 455..489 CDD:238060 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.