Sequence 1: | NP_001261577.1 | Gene: | ImpE1 / 45879 | FlyBaseID: | FBgn0001253 | Length: | 1616 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005259002.1 | Gene: | LRP3 / 4037 | HGNCID: | 6695 | Length: | 785 | Species: | Homo sapiens |
Alignment Length: | 443 | Identity: | 101/443 - (22%) |
---|---|---|---|
Similarity: | 121/443 - (27%) | Gaps: | 214/443 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 1304 LMEPAAPVVTTLMPLMTADEPTPEP--VSPAAIPSASLAAIKPGTELRKRVDLGL--EAVSLGLA 1364
Fly 1365 ----------------CSSDR-QCQ----LADPHTVCNRRGVCDCAAGEEGSQCSA---ERTG-- 1403
Fly 1404 CSPGTFQCRSSGV----CISWFFVCDGRADCNDASDE---------------------------- 1436
Fly 1437 ------ECT---------------------------------HNARLNQTCPTES---------- 1452
Fly 1453 ---------FRCQRSGR----------------------------------CISRAALCDGRRQC 1474
Fly 1475 PHGEDELGCDGSVKGGNACPEHTFRC--GSGECLPEYEYCNAIVSCKDGSDEPPHLCGSRALPNL 1537
Fly 1538 FMRLIEAGGLLGGGRREADAYCPHRCSNGLCRSTAIVCSGRDGCGDGTDEQTC 1590 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpE1 | NP_001261577.1 | EB | 75..131 | CDD:279949 | |
LDLa | 1404..1437 | CDD:238060 | 17/70 (24%) | ||
LDLa | 1448..1483 | CDD:238060 | 12/87 (14%) | ||
LDLa | 1493..1524 | CDD:238060 | 13/32 (41%) | ||
LDLa | 1561..1590 | CDD:238060 | 10/28 (36%) | ||
LRP3 | XP_005259002.1 | CUB | 43..156 | CDD:238001 | 18/70 (26%) |
LDLa | 166..200 | CDD:238060 | 10/36 (28%) | ||
LDLa | 212..249 | CDD:238060 | 17/38 (45%) | ||
CUB | 254..364 | CDD:238001 | 9/109 (8%) | ||
LDLa | 416..452 | CDD:238060 | 15/37 (41%) | ||
LDLa | 455..489 | CDD:238060 | 12/56 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |