DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpE1 and cue

DIOPT Version :9

Sequence 1:NP_001261577.1 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster
Sequence 2:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster


Alignment Length:165 Identity:39/165 - (23%)
Similarity:52/165 - (31%) Gaps:65/165 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VVDASRSLEL------------GDKCQHDMD---------CTDFIKGSSCSALGYCECAPYFVQL 82
            |.:.||..|:            .::|.:|.:         |....|||.|...   ||..|.|. 
  Fly   348 VDEQSRKFEIRSLLDQKIKVLEDERCMNDGEYRAATDLCICPTGFKGSRCEIR---ECHNYCVH- 408

  Fly    83 DSKRCLSSQLLGGDCQLSEQCSMKVANSSCLEGACRCVEGFLQFR--KHTCLGPAHPGAVCYSHA 145
                        |.||:||....|          |.|..||...|  ...|.|      :|.:..
  Fly   409 ------------GTCQMSELAYPK----------CYCQPGFKGERCELSVCSG------LCLNGG 445

  Fly   146 HCQMFDTRTHCDFLIPNLFGRCQCTSPAKMVGGLC 180
            ||::.......    |:    |:|  |||..|..|
  Fly   446 HCRVSKDENEA----PS----CEC--PAKFGGARC 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpE1NP_001261577.1 EB 75..131 CDD:279949 14/57 (25%)
LDLa 1404..1437 CDD:238060
LDLa 1448..1483 CDD:238060
LDLa 1493..1524 CDD:238060
LDLa 1561..1590 CDD:238060
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.