DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpE1 and CG6553

DIOPT Version :9

Sequence 1:NP_001261577.1 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster
Sequence 2:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster


Alignment Length:150 Identity:50/150 - (33%)
Similarity:68/150 - (45%) Gaps:17/150 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1388 CAAGEEGSQCSAERTGCSPGTFQCRSSGVCISWFFVCDGRADCNDASDEECTHNARLNQTCPTES 1452
            |...:..:.| ..|.|          .|.||....:|||.|:|.|.|||......::  .||..:
  Fly    23 CLGSQNATSC-GHRCG----------GGDCIQLDQLCDGSANCLDGSDETVAMCEKV--WCPGYA 74

  Fly  1453 FRCQRSGRCISRAALCDGRRQCPHGEDELG--CDGSVKGGNACPEHTFRCGSGECLPEYEYCNAI 1515
            |||. .|.||:..|:|||.:.|..|.||.|  |...::..| |......|.||:|:...:.|:.|
  Fly    75 FRCS-YGACIASTAVCDGVQDCVDGSDEQGWLCRAQMQQAN-CDNWEMYCSSGQCMTYSKLCDGI 137

  Fly  1516 VSCKDGSDEPPHLCGSRALP 1535
            ..|:||.||...||....:|
  Fly   138 RDCRDGDDELESLCEGVTIP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpE1NP_001261577.1 EB 75..131 CDD:279949
LDLa 1404..1437 CDD:238060 11/32 (34%)
LDLa 1448..1483 CDD:238060 17/36 (47%)
LDLa 1493..1524 CDD:238060 10/30 (33%)
LDLa 1561..1590 CDD:238060
CG6553NP_610911.1 LDLa 34..60 CDD:197566 12/35 (34%)
LDLa 70..101 CDD:197566 14/31 (45%)
LDLa 115..146 CDD:197566 10/30 (33%)
Frag1 <260..>303 CDD:287278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.