DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ImpE1 and LRP12

DIOPT Version :9

Sequence 1:	NP_001261577.1	Gene:	ImpE1 / 45879	FlyBaseID:	FBgn0001253	Length:	1616	Species:	Drosophila melanogaster
Sequence 2:	NP_038465.1	Gene:	LRP12 / 29967	HGNCID:	31708	Length:	859	Species:	Homo sapiens

Alignment Length:	201	Identity:	53/201 - (26%)
Similarity:	68/201 - (33%)	Gaps:	76/201 - (37%)

- Green bases have known domain annotations that are detailed below.

  Fly  1399 AERTGCSPG---TFQCRSSGVCISWFFVCDGRADCNDASDEECTHNARLNQTCPTESFRCQRSGR 1460
            |::...:.|   |:|.  .|.|:.|...|.|                  |..|.||..|
Human   356 ADKVNAARGFNATYQV--DGFCLPWEIPCGG------------------NWGCYTEQQR------ 394

  Fly  1461 CISRAALCDGRRQCPHGEDELGCDGSVKGGNACPEHTFRCG-SGECLPEYEYCNAIVSCKDGSDE 1524
                   |||...||:|.||..|       ..|.:..|.|. :|.|.|..:.||....|.:||||
Human   395 -------CDGYWHCPNGRDETNC-------TMCQKEEFPCSRNGVCYPRSDRCNYQNHCPNGSDE 445

  Fly  1525 PPHLCGSRALPNLFMRLIEAGGLLGGGRREADAYCP---HRCSNGLCRSTAIVCSGRDGCGDGTD 1586
                      .|.|                   :|.   ..|.|..|...:.||..:|.||||:|
Human   446 ----------KNCF-------------------FCQPGNFHCKNNRCVFESWVCDSQDDCGDGSD 481

  Fly  1587 EQTCSV 1592
            |:.|.|
Human   482 EENCPV 487

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ImpE1	NP_001261577.1	EB	75..131	CDD:279949
		LDLa	1404..1437	CDD:238060	8/35 (23%)
		LDLa	1448..1483	CDD:238060	12/34 (35%)
		LDLa	1493..1524	CDD:238060	11/31 (35%)
		LDLa	1561..1590	CDD:238060	12/28 (43%)
LRP12	NP_038465.1	CUB	47..158	CDD:238001
		LDLa	166..200	CDD:238060
		LDLa	215..254	CDD:238060
		CUB	267..371	CDD:238001	3/14 (21%)
		LDLa	375..410	CDD:238060	17/65 (26%)
		LDLa	413..448	CDD:238060	13/44 (30%)
		LDLa	451..485	CDD:238060	13/33 (39%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	623..678
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	693..723
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	748..770
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	801..823
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1215
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900