Sequence 1: | NP_001261577.1 | Gene: | ImpE1 / 45879 | FlyBaseID: | FBgn0001253 | Length: | 1616 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038465.1 | Gene: | LRP12 / 29967 | HGNCID: | 31708 | Length: | 859 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 53/201 - (26%) |
---|---|---|---|
Similarity: | 68/201 - (33%) | Gaps: | 76/201 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 1399 AERTGCSPG---TFQCRSSGVCISWFFVCDGRADCNDASDEECTHNARLNQTCPTESFRCQRSGR 1460
Fly 1461 CISRAALCDGRRQCPHGEDELGCDGSVKGGNACPEHTFRCG-SGECLPEYEYCNAIVSCKDGSDE 1524
Fly 1525 PPHLCGSRALPNLFMRLIEAGGLLGGGRREADAYCP---HRCSNGLCRSTAIVCSGRDGCGDGTD 1586
Fly 1587 EQTCSV 1592 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpE1 | NP_001261577.1 | EB | 75..131 | CDD:279949 | |
LDLa | 1404..1437 | CDD:238060 | 8/35 (23%) | ||
LDLa | 1448..1483 | CDD:238060 | 12/34 (35%) | ||
LDLa | 1493..1524 | CDD:238060 | 11/31 (35%) | ||
LDLa | 1561..1590 | CDD:238060 | 12/28 (43%) | ||
LRP12 | NP_038465.1 | CUB | 47..158 | CDD:238001 | |
LDLa | 166..200 | CDD:238060 | |||
LDLa | 215..254 | CDD:238060 | |||
CUB | 267..371 | CDD:238001 | 3/14 (21%) | ||
LDLa | 375..410 | CDD:238060 | 17/65 (26%) | ||
LDLa | 413..448 | CDD:238060 | 13/44 (30%) | ||
LDLa | 451..485 | CDD:238060 | 13/33 (39%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 623..678 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 693..723 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 748..770 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 801..823 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |