DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpE1 and Lrp5

DIOPT Version :9

Sequence 1:NP_001261577.1 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster
Sequence 2:NP_001099791.2 Gene:Lrp5 / 293649 RGDID:1309329 Length:1600 Species:Rattus norvegicus


Alignment Length:419 Identity:91/419 - (21%)
Similarity:140/419 - (33%) Gaps:123/419 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1213 EPEEVNTP----LPEELPFDLTDHSDVNRFNELQSESLI--LESTTNIDGLQELDNNHI------ 1265
            :|..:.:|    .|:..|.||:        .::.|.:|.  .|:|..|: :..||.:.:      
  Rat  1009 QPSMLTSPSQSLSPDRQPHDLS--------IDIYSRTLFWTCEATNTIN-VHRLDGDAMGVVLRG 1064

  Fly  1266 EEEEPAAHAIPHEEA----TPNPADIVEITTQTMLGLASRVT----LMEPAAPVVTTLM------ 1316
            :.:.|.|.|:..|..    |.......:|...::.|....|.    |:.|.|.||...:      
  Rat  1065 DRDRPRAIAVNAERGYMYFTNMQDHAAKIERASLDGTEREVLFTTGLIRPVALVVDNALGKLFWV 1129

  Fly  1317 ----------PLMTADEPTPEP---VSPAAI------------PSASLAAIKPGT-ELRKRVDLG 1355
                      .|..|:..|.|.   |.|..:            ....:..::..| :.|.||. |
  Rat  1130 DADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQ-G 1193

  Fly  1356 LEAVSLGLACSSDRQCQLADPHTVCNRRGVCD--CAAGEEGS-QCS--------------AERTG 1403
            ......|:....:...:....|......|.|.  |.|..:|: :||              .|...
  Rat  1194 RVTHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPT 1258

  Fly  1404 CSPGTFQCRSSGV-CISWFFVCDGRADCNDASDEE-CTHNARLNQTCPTESFRCQRSGRCISRAA 1466
            |||..|.|.:..: ||...:.|||..:|.|.|||| |       ..|....|.|.| |:|:....
  Rat  1259 CSPDQFACATGEIDCIPGAWRCDGFPECADQSDEEGC-------PVCSASQFPCAR-GQCVDLRL 1315

  Fly  1467 LCDGRRQCPHGEDELGCDGSVKGGNACPEHTFRCGSGECLPEYEYCNAIVSCKDGSDE------- 1524
            .||.                     .|..:.|||.||:|:...:.|::...|.|||||       
  Rat  1316 RCDA---------------------VCLPNQFRCASGQCVLIKQQCDSFPDCADGSDELMCEINK 1359

  Fly  1525 ------PPHLCGSRALPNLFMRLIEAGGL 1547
                  |.|......:..:.:.|...||:
  Rat  1360 PPSDDVPAHSSAIGPVIGIILSLFVMGGV 1388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpE1NP_001261577.1 EB 75..131 CDD:279949
LDLa 1404..1437 CDD:238060 14/33 (42%)
LDLa 1448..1483 CDD:238060 8/34 (24%)
LDLa 1493..1524 CDD:238060 12/30 (40%)
LDLa 1561..1590 CDD:238060
Lrp5NP_001099791.2 NHL <37..>169 CDD:302697
NHL repeat 65..104 CDD:271320
LY 102..142 CDD:214531
NHL repeat 107..148 CDD:271320
Ldl_recept_b 163..203 CDD:278487
LY 187..229 CDD:214531
LY 230..271 CDD:214531
FXa_inhibition 299..336 CDD:291342
LY 366..406 CDD:214531
LY 408..450 CDD:214531
LY 451..494 CDD:214531
LY 495..537 CDD:214531
LY 538..571 CDD:214531
FXa_inhibition 605..640 CDD:291342
NHL 685..878 CDD:302697
LY 710..752 CDD:214531
NHL repeat 720..756 CDD:271320
NHL repeat 763..802 CDD:271320
NHL repeat 808..843 CDD:271320
NHL repeat 847..871 CDD:271320
FXa_inhibition 906..941 CDD:291342
LY 1060..1103 CDD:214531 7/42 (17%)
LY 1104..1146 CDD:214531 8/41 (20%)
FXa_inhibition 1217..1253 CDD:291342 7/35 (20%)
LDLa 1259..1295 CDD:238060 16/35 (46%)
LDLa 1321..1355 CDD:238060 14/33 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.