DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpE1 and Lrp12

DIOPT Version :9

Sequence 1:NP_001261577.1 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster
Sequence 2:XP_006520965.1 Gene:Lrp12 / 239393 MGIID:2443132 Length:859 Species:Mus musculus


Alignment Length:201 Identity:53/201 - (26%)
Similarity:69/201 - (34%) Gaps:76/201 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1399 AERTGCSPG---TFQCRSSGVCISWFFVCDGRADCNDASDEECTHNARLNQTCPTESFRCQRSGR 1460
            |::...:.|   |:|.  .|.|:.|...|.|                  |..|.||..|      
Mouse   357 ADKVNAARGFNATYQV--DGFCLPWEIPCGG------------------NWGCYTEQQR------ 395

  Fly  1461 CISRAALCDGRRQCPHGEDELGCDGSVKGGNACPEHTFRCG-SGECLPEYEYCNAIVSCKDGSDE 1524
                   |||...||:|.||:.|       ..|.:..|.|. :|.|.|..:.||....|.:||||
Mouse   396 -------CDGYWHCPNGRDEINC-------TMCQKEEFPCSRNGVCYPRSDRCNYQNHCPNGSDE 446

  Fly  1525 PPHLCGSRALPNLFMRLIEAGGLLGGGRREADAYCP---HRCSNGLCRSTAIVCSGRDGCGDGTD 1586
                      .|.|                   :|.   ..|.|..|...:.||..:|.||||:|
Mouse   447 ----------KNCF-------------------FCQPGNFHCKNNRCVFESWVCDSQDDCGDGSD 482

  Fly  1587 EQTCSV 1592
            |:.|.|
Mouse   483 EENCPV 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpE1NP_001261577.1 EB 75..131 CDD:279949
LDLa 1404..1437 CDD:238060 8/35 (23%)
LDLa 1448..1483 CDD:238060 12/34 (35%)
LDLa 1493..1524 CDD:238060 11/31 (35%)
LDLa 1561..1590 CDD:238060 12/28 (43%)
Lrp12XP_006520965.1 CUB 47..156 CDD:366096
LDLa 167..201 CDD:238060
LDLa 216..255 CDD:238060
CUB 268..372 CDD:238001 3/14 (21%)
LDLa 376..411 CDD:238060 17/65 (26%)
LDLa 414..449 CDD:238060 13/44 (30%)
LDLa 452..486 CDD:238060 13/33 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.