| Sequence 1: | NP_001261577.1 | Gene: | ImpE1 / 45879 | FlyBaseID: | FBgn0001253 | Length: | 1616 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_038731.2 | Gene: | Vldlr / 22359 | MGIID: | 98935 | Length: | 873 | Species: | Mus musculus |
| Alignment Length: | 296 | Identity: | 83/296 - (28%) |
|---|---|---|---|
| Similarity: | 113/296 - (38%) | Gaps: | 76/296 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1359 VSLGLACSSDRQC------------QLADPHTVCNRRGVC-----------DCAAGEEGS----- 1395
Fly 1396 --QCSAERTGCSPGTFQCRSSGVCISWFFVCDGRADCNDASDEE-CTHNARLNQTCPTESFRCQR 1457
Fly 1458 SGRCISRAALCDGRRQCPHGEDELGCDGSVKGGNACPEHTFRCGSGECLPEYEYCNAIVSCKDGS 1522
Fly 1523 DEPPHLCGSRALPNLFMRLIEAGGLLGGG-------RREAD---------AYCPHR--------C 1563
Fly 1564 SNGLCRSTAIVCSGRDGCGDGTDEQTC-SVCRCPAP 1598 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ImpE1 | NP_001261577.1 | EB | 75..131 | CDD:279949 | |
| LDLa | 1404..1437 | CDD:238060 | 11/32 (34%) | ||
| LDLa | 1448..1483 | CDD:238060 | 16/34 (47%) | ||
| LDLa | 1493..1524 | CDD:238060 | 10/30 (33%) | ||
| LDLa | 1561..1590 | CDD:238060 | 11/36 (31%) | ||
| Vldlr | NP_038731.2 | LDLa | 33..67 | CDD:238060 | 4/20 (20%) |
| LDLa | 71..103 | CDD:197566 | 8/32 (25%) | ||
| Ldl_recept_a | 111..149 | CDD:365841 | 14/43 (33%) | ||
| Ldl_recept_a | 153..188 | CDD:365841 | 17/35 (49%) | ||
| Ldl_recept_a | 192..224 | CDD:365841 | 10/31 (32%) | ||
| Ldl_recept_a | 237..273 | CDD:365841 | 4/35 (11%) | ||
| Ldl_recept_a | 276..312 | CDD:365841 | 11/35 (31%) | ||
| Ldl_recept_a | 320..350 | CDD:365841 | 1/2 (50%) | ||
| FXa_inhibition | 360..394 | CDD:373209 | |||
| EGF_CA | 396..426 | CDD:214542 | |||
| LDL-receptor class B 1 | 439..480 | ||||
| LY | 461..499 | CDD:214531 | |||
| LDL-receptor class B 2 | 481..524 | ||||
| Ldl_recept_b | 481..521 | CDD:278487 | |||
| LY | 508..547 | CDD:214531 | |||
| LDL-receptor class B 3 | 525..567 | ||||
| LDL-receptor class B 4 | 568..611 | ||||
| Ldl_recept_b | 568..608 | CDD:278487 | |||
| LY | 592..634 | CDD:214531 | |||
| LDL-receptor class B 5 | 612..654 | ||||
| LDL-receptor class B 6 | 655..697 | ||||
| Ldl_recept_b | 655..694 | CDD:278487 | |||
| FXa_inhibition | 711..749 | CDD:373209 | |||
| Clustered O-linked oligosaccharides | 751..790 | ||||
| Endocytosis signal. /evidence=ECO:0000255 | 832..837 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||