DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpE1 and egg-1

DIOPT Version :9

Sequence 1:NP_001261577.1 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster
Sequence 2:NP_498237.2 Gene:egg-1 / 175804 WormBaseID:WBGene00015083 Length:551 Species:Caenorhabditis elegans


Alignment Length:278 Identity:77/278 - (27%)
Similarity:103/278 - (37%) Gaps:76/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1365 CSSDRQCQL-------------ADPHTVC-NRRGVCD----CAAGEEGSQCSAERTGCSPGTFQC 1411
            |.|...|:|             ..|..:| ..:.:||    |..|.:.:.|   ::.||...|:|
 Worm   162 CQSVFSCKLRPEEESKKKGRSTVQPTLICLTAQHLCDNVENCPDGSDEAVC---KSSCSKDQFKC 223

  Fly  1412 RSSGVCISWFFVCDGRADCNDASDEE-CTHNARLNQTCPTESFRCQRSGRCISRAALCDGRRQCP 1475
            ..|..|:.....|||..||.|||||: |:       .|...:.:|.:  :||..:.:|||..||.
 Worm   224 PGSNACLPLSAKCDGINDCADASDEKNCS-------KCQNNAHKCGK--QCIKASHVCDGVAQCA 279

  Fly  1476 HGEDELGCD-----GSVKGGNACPEHTFRCGSGECLPEYEYCNAIVSCKDGSDEP--PHLCGSRA 1533
            .|.||..||     |:.|.         .|..|.|:...:.|:....|.||.||.  |..|...:
 Worm   280 DGSDEQQCDCQRCSGTDKA---------LCDDGTCIMRTQVCDGKKDCTDGMDEEDCPGSCTIES 335

  Fly  1534 L-PNLFMRLIEAGGLLGGGRREADA------YCPHRCSNG------------------LCRSTAI 1573
            . |.|.|.....|...    .||:|      .|.|.|.|.                  :|.|...
 Worm   336 FSPKLKMVTCSDGKQY----TEAEACSGSFESCDHDCPNSKCHPKLAFTCPASKEARKMCISRRK 396

  Fly  1574 VCSGRDGCGDGTDEQTCS 1591
            ||.|...|.||.||..|:
 Worm   397 VCDGTPDCDDGADEINCT 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpE1NP_001261577.1 EB 75..131 CDD:279949
LDLa 1404..1437 CDD:238060 15/32 (47%)
LDLa 1448..1483 CDD:238060 12/34 (35%)
LDLa 1493..1524 CDD:238060 7/30 (23%)
LDLa 1561..1590 CDD:238060 13/46 (28%)
egg-1NP_498237.2 LDLa 123..159 CDD:238060
LDLa 216..251 CDD:238060 16/34 (47%)
LDLa 254..287 CDD:238060 12/34 (35%)
LDLa 300..327 CDD:238060 9/26 (35%)
LDLa <391..413 CDD:238060 10/21 (48%)
LDLa 425..455 CDD:238060
LDLa 458..493 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.