| Sequence 1: | NP_001261577.1 | Gene: | ImpE1 / 45879 | FlyBaseID: | FBgn0001253 | Length: | 1616 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_032540.2 | Gene: | Lrp6 / 16974 | MGIID: | 1298218 | Length: | 1613 | Species: | Mus musculus |
| Alignment Length: | 394 | Identity: | 89/394 - (22%) |
|---|---|---|---|
| Similarity: | 137/394 - (34%) | Gaps: | 132/394 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1227 FDLTDHSDVNRFNELQSESLILE----------STTNIDGLQELDNNHI------EEEEPAAHAI 1275
Fly 1276 PHE----------EATPN-------------------------------------PADIVEITTQ 1293
Fly 1294 TMLGLASRVTLMEPAAPVVTTLMPLMTADEPTPEPVSPAAIPSASLAAIKPGTELRKRVDL-GLE 1357
Fly 1358 AVSLGLACSSDRQCQLADPHTV------------CNR-RGVCD--C-AAGEEGSQCS-------- 1398
Fly 1399 ------AERTGCSPGTFQCRSSGV-CISWFFVCDGRADCNDASDEECTHNARLN-QTCPTESFRC 1455
Fly 1456 QRSGRCISRAALCDGRRQCPHGEDELGCDGSVKGGNACPEHTFRCGSGECLPEYEYCNAIVSCKD 1520
Fly 1521 GSDE 1524 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ImpE1 | NP_001261577.1 | EB | 75..131 | CDD:279949 | |
| LDLa | 1404..1437 | CDD:238060 | 14/33 (42%) | ||
| LDLa | 1448..1483 | CDD:238060 | 13/34 (38%) | ||
| LDLa | 1493..1524 | CDD:238060 | 11/30 (37%) | ||
| LDLa | 1561..1590 | CDD:238060 | |||
| Lrp6 | NP_032540.2 | Beta-propeller 1 | 20..275 | ||
| NHL | 55..272 | CDD:302697 | |||
| NHL repeat | 55..93 | CDD:271320 | |||
| LY | 89..127 | CDD:214531 | |||
| NHL repeat | 97..132 | CDD:271320 | |||
| NHL repeat | 140..176 | CDD:271320 | |||
| Ldl_recept_b | 150..190 | CDD:278487 | |||
| LY | 175..216 | CDD:214531 | |||
| NHL repeat | 181..217 | CDD:271320 | |||
| NHL repeat | 226..253 | CDD:271320 | |||
| LDL-receptor class B 5 | 236..277 | ||||
| FXa_inhibition | 286..323 | CDD:291342 | |||
| Beta-propeller 2 | 328..589 | ||||
| LY | 353..393 | CDD:214531 | |||
| LY | 397..437 | CDD:214531 | |||
| LY | 438..481 | CDD:214531 | |||
| LY | 483..524 | CDD:214531 | |||
| LY | 525..558 | CDD:214531 | |||
| FXa_inhibition | 592..627 | CDD:291342 | |||
| Beta-propeller 3 | 631..890 | ||||
| LY | 656..694 | CDD:214531 | |||
| LY | 697..739 | CDD:214531 | |||
| LY | 740..783 | CDD:214531 | |||
| LY | 783..825 | CDD:214531 | |||
| LY | 827..866 | CDD:214531 | |||
| FXa_inhibition | 893..929 | CDD:291342 | |||
| Beta-propeller 4 | 933..1202 | 37/223 (17%) | |||
| LY | 958..998 | CDD:214531 | |||
| LY | 1050..1093 | CDD:214531 | 6/42 (14%) | ||
| LY | 1094..1136 | CDD:214531 | 4/42 (10%) | ||
| FXa_inhibition | 1207..1243 | CDD:291342 | 7/35 (20%) | ||
| LDLa | 1249..1285 | CDD:238060 | 16/42 (38%) | ||
| LDLa | 1288..1322 | CDD:238060 | 13/34 (38%) | ||
| LDLa | 1326..1360 | CDD:238060 | 13/32 (41%) | ||
| PPPSP motif A | 1487..1493 | ||||
| PPPSP motif B | 1527..1534 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1556..1613 | ||||
| PPPSP motif C | 1568..1575 | ||||
| PPPSP motif D | 1588..1593 | ||||
| PPPSP motif E | 1603..1610 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||