DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpE1 and LDLRAD3

DIOPT Version :9

Sequence 1:NP_001261577.1 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster
Sequence 2:NP_777562.1 Gene:LDLRAD3 / 143458 HGNCID:27046 Length:345 Species:Homo sapiens


Alignment Length:165 Identity:49/165 - (29%)
Similarity:72/165 - (43%) Gaps:27/165 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1334 IPSASLAAIKPGTELRKRVDLGLEAVSLGLACSSDR------QCQLADPHTVCNRRGVCDCAAGE 1392
            :.||:.:.:.||.......:     :.....||:.|      ||.           |:.||....
Human    11 LSSAAESQLLPGNNFTNECN-----IPGNFMCSNGRCIPGAWQCD-----------GLPDCFDKS 59

  Fly  1393 EGSQCSAERTGCSPGTFQCRSSGVCISWFFVCDGRADCNDASDEE-CTHNARLNQTCPTESFRCQ 1456
            :..:|...::.|.|..|.|.|...||...|.|:|..||.|.|||| ||.|..|   |.|..:.| 
Human    60 DEKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLL---CSTARYHC- 120

  Fly  1457 RSGRCISRAALCDGRRQCPHGEDELGCDGSVKGGN 1491
            ::|.||.::.:|||:..|....||..|:.|.:.|:
Human   121 KNGLCIDKSFICDGQNNCQDNSDEESCESSQEPGS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpE1NP_001261577.1 EB 75..131 CDD:279949
LDLa 1404..1437 CDD:238060 15/32 (47%)
LDLa 1448..1483 CDD:238060 12/34 (35%)
LDLa 1493..1524 CDD:238060
LDLa 1561..1590 CDD:238060
LDLRAD3NP_777562.1 LDLa 32..64 CDD:238060 8/42 (19%)
LDLa 71..106 CDD:238060 17/34 (50%)
LDLa 113..147 CDD:238060 12/34 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.