DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpE1 and Egf

DIOPT Version :9

Sequence 1:NP_001261577.1 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster
Sequence 2:XP_011238312.1 Gene:Egf / 13645 MGIID:95290 Length:1221 Species:Mus musculus


Alignment Length:237 Identity:54/237 - (22%)
Similarity:79/237 - (33%) Gaps:87/237 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1329 VSPAAIPSASLAAIKPGTELRKRVDLGLEAVSLGLACSSDRQCQLADPHTVCNRRGVCD------ 1387
            |.|.|.|....||..||           |::...|.....|.|          |.|:|:      
Mouse   304 VHPRAQPRTEDAAKDPG-----------ESLDPELLKQRGRPC----------RFGLCERDPKSH 347

  Fly  1388 ---CAAG----------EEGSQCSAERTGC------SPGTFQCRSSGVCISWFFVCDGRADCND- 1432
               ||.|          |:.::|:.:..||      :||::.|    .|.:.|.:......|:: 
Mouse   348 SSACAEGYTLSRDRKYCEDVNECATQNHGCTLGCENTPGSYHC----TCPTGFVLLPDGKQCHEL 408

  Fly  1433 ----ASDEECTHNARLNQTCPTESFRCQRSGRCISRAALCDGRRQCPHGEDELGCDGSVKGGNAC 1493
                .:..:|:|...|....|          |||           ||.| ..||.||....|.:.
Mouse   409 VSCPGNVSKCSHGCVLTSDGP----------RCI-----------CPAG-SVLGRDGKTCTGCSS 451

  Fly  1494 PEH--------TFRCGSGE--CLPEYEYCNAIVSCKDGSDEP 1525
            |::        ..|.||.|  |.|.|:..:...||.....:|
Mouse   452 PDNGGCSQICLPLRPGSWECDCFPGYDLQSDRKSCAASGPQP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpE1NP_001261577.1 EB 75..131 CDD:279949
LDLa 1404..1437 CDD:238060 7/43 (16%)
LDLa 1448..1483 CDD:238060 8/34 (24%)
LDLa 1493..1524 CDD:238060 10/40 (25%)
LDLa 1561..1590 CDD:238060
EgfXP_011238312.1 LY <86..114 CDD:214531
LY <125..156 CDD:214531
LY 158..199 CDD:214531
FXa_inhibition 370..405 CDD:373209 8/38 (21%)
FXa_inhibition 418..446 CDD:373209 14/49 (29%)
FXa_inhibition 453..486 CDD:373209 7/32 (22%)
LY 514..556 CDD:214531
LY 557..599 CDD:214531
LY 600..643 CDD:214531
LY 643..686 CDD:214531
LY 687..728 CDD:214531
FXa_inhibition 755..790 CDD:373209
EGF_CA 881..921 CDD:311536
EGF_CA 923..>951 CDD:311536
PHA02887 <986..1023 CDD:165214
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.