DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hex-A and YLR446W

DIOPT Version :9

Sequence 1:NP_524848.1 Gene:Hex-A / 45875 FlyBaseID:FBgn0001186 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_013551.1 Gene:YLR446W / 851167 SGDID:S000004438 Length:433 Species:Saccharomyces cerevisiae


Alignment Length:491 Identity:105/491 - (21%)
Similarity:175/491 - (35%) Gaps:160/491 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KSKMVHELCQQLLLTDEQVQELCYRILHELRRGLAKDTHPKANVKCFVTYVQDLP---------N 146
            :|.:..|| :.|:|..:.:..:..:...||...|..:|            :..||         .
Yeast     4 ESTLAREL-ESLILPADSIVNVVDQFQEELLSRLQTNT------------ISMLPQCLVPDKRSR 55

  Fly   147 GNERGKFLALDLGGTNFRVLLIHLQE-----NNDFQMESRIYAIPQHIMIGSGTQLFDHIAECLS 206
            .|...|.|.:|.|||..:..:|.|.:     |:.|::...|.          .:..|:.|...:.
Yeast    56 WNPEDKILTIDFGGTRLKFAIISLPQIVIEYNDAFELTYNIV----------DSNFFNQIIYTIC 110

  Fly   207 NFMAEHNVYKE--------RLPLGFTFSFPLRQLG----LTKGLLETWTKGFNCAGVVNEDVVQL 259
            ..:|.:...|:        :..:..||||||...|    :.||.:.|.|       :....|.||
Yeast   111 TRLAANGYIKKKNESSEASKFFVSVTFSFPLNPEGEVVAMGKGFVMTDT-------LQGSTVKQL 168

  Fly   260 LKDAIARRGDVQID-------VCAILNDTTGTLMSCAWKNHNCKIGLIVGTGANACY-------- 309
            ::.:..|.....|:       ||.::||.....::..:...|..|.||:|||.|||:        
Yeast   169 IQSSFHRIISENIEEFFCTMNVCHVINDAIAVSLTSKFICENDSISLIIGTGTNACFEVPYGYLP 233

  Fly   310 ---MERVEEA--ELFAAEDPRKKHVLINTEWGAFGDNG-ALDFVRTEFDRDIDVHSINPGKQTFE 368
               .:.:.|.  ..:..|....||||||:|.|..|.|. ||        :..|:|.....:...|
Yeast   234 PFKRDALRETLPSSYNKETLNFKHVLINSEIGFIGKNVIAL--------QPFDIHGAISYEMPLE 290

  Fly   369 KMISGMYMGELVRLVLVKMTQAGIL-------FNGQDSEVLNTRGLFFTKYVSEIEADEPGNFTN 426
            .:.||.::...::.:|:   |..|:       |||:                           ..
Yeast   291 CVTSGKWLPLSLKNILL---QYNIIPKNFPVEFNGE---------------------------LV 325

  Fly   427 CRLVLEELGLTNATDGDCANVRY-------ICE---CVSKRAAHLVSAGIATLINKMDEPT---- 477
            |:|.           .||.|..:       ||:   .:.||||..|:|    ::..:|..|    
Yeast   326 CQLA-----------EDCTNAWFENEHYALICQIARLLIKRAAFYVAA----IVQAIDIITGCKN 375

  Fly   478 ---VTVGVDGS------VYRFHPKFHNLMVEKISQL 504
               :.:|..||      .||...|:::.:..|:..|
Yeast   376 YNFIHIGYVGSFLHNSNFYREQIKYYSSIHIKLQFL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hex-ANP_524848.1 Hexokinase_1 95..290 CDD:395278 46/227 (20%)
Hexokinase_2 296..530 CDD:397683 57/253 (23%)
YLR446WNP_013551.1 COG5026 1..433 CDD:227359 105/491 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.