DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grau and ZAP1

DIOPT Version :9

Sequence 1:NP_788422.1 Gene:grau / 45871 FlyBaseID:FBgn0001133 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_012479.1 Gene:ZAP1 / 853390 SGDID:S000003592 Length:880 Species:Saccharomyces cerevisiae


Alignment Length:483 Identity:92/483 - (19%)
Similarity:160/483 - (33%) Gaps:157/483 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 DNDVGAQINVNPLDELDLSQPMSPEDSKVGIKTERQSPDM-ELLFEDANNEQD---EDYEDDEDD 168
            ::.:.|......|...||:..:|.|.|....:.:.:.|.: ::..::..|.:.   :|.|..:..
Yeast   481 NSGISAANTTADLTNNDLNDLISREYSYERFRNQSEPPSLPKVTHQNQKNRRSWPTKDLESTDFS 545

  Fly   169 DTDDLIVTRSGRKRKRDVAKPAKTKRGTVSVGRKGKEKMVVKRGPPKRIFKMERLPPFCKE---- 229
            ..:|.:.:        .::.|.:| ..|::.....||:   |....|  .|.:..|..|..    
Yeast   546 SLEDSLPS--------SISPPIQT-TSTINFNWCFKEE---KNNDLK--CKWKECPESCSSLFDL 596

  Fly   230 DEELIKRYI---------VMGC--ELCIFLAEDFDGIREHFKDKH----------PD-------- 265
            ...|:|.::         .:.|  |.|.||.:|...|..|...:|          ||        
Yeast   597 QRHLLKDHVSQDFKHPMEPLACNWEDCDFLGDDTCSIVNHINCQHGINFDIQFANPDSFLPGSIS 661

  Fly   266 -ERPYIKCCGRKLNKRCLIQEHARRHE-----------------------NPEYIKCK--DCGKV 304
             |:.::..|           .:.:.||                       .||.:.|:  .|.|.
Yeast   662 KEKHHLLHC-----------PNPQTHEVSKADGAPDMTSANDVSNIPPIKQPEQVICQWDGCNKS 715

  Fly   305 FANSSVLRAHWLVHHVPDEECDFQC--EDCGKRFSRRNLLELHKGSHVPVNERKFICPQCPKHNA 367
            |:::..|..|....|:...:.::||  .||.:.|.:|..|..|...|......|  |..|.:  .
Yeast   716 FSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYK--CKTCKR--C 776

  Fly   368 FATEYHMQVHISMQHRKAANICHVCGKKIKDKAVFEKHVRLHFEESGPRIKCPRPDCESWLKDED 432
            |::|..:..|......:....||:|.||.   |:                             ..
Yeast   777 FSSEETLVQHTRTHSGEKPYKCHICNKKF---AI-----------------------------SS 809

  Fly   433 NLKQHLRRHNDEGKLFICSECGKSCKNSRALIGHKRYSHSNVIYTCEQCGKTFKKDISLKEHMAQ 497
            :||.|:|.|..|..|                             .|:.|||.|.:..:|.:|:..
Yeast   810 SLKIHIRTHTGEKPL-----------------------------QCKICGKRFNESSNLSKHIKT 845

  Fly   498 HTGEPLYKCPFCPRTFNSNANMHSHKKK 525
            |  :..|||..|.::|:....::|.|.|
Yeast   846 H--QKKYKCSDCSKSFDDLGKLNSQKVK 871

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grauNP_788422.1 zf-AD 3..77 CDD:285071
C2H2 Zn finger 272..290 CDD:275368 1/17 (6%)
COG5048 <296..453 CDD:227381 35/160 (22%)
C2H2 Zn finger 298..318 CDD:275368 6/21 (29%)
SIR2 <316..>415 CDD:294129 22/100 (22%)
C2H2 Zn finger 329..349 CDD:275368 7/21 (33%)
C2H2 Zn finger 359..409 CDD:275368 11/49 (22%)
C2H2 Zn finger 360..378 CDD:275370 3/17 (18%)
zf-C2H2_8 419..495 CDD:292531 13/75 (17%)
C2H2 Zn finger 450..471 CDD:275368 0/20 (0%)
C2H2 Zn finger 478..498 CDD:275368 7/19 (37%)
C2H2 Zn finger 506..524 CDD:275368 4/17 (24%)
ZAP1NP_012479.1 COG5048 292..761 CDD:227381 56/304 (18%)
C2H2 Zn finger 743..762 CDD:275368 6/18 (33%)
SUF4-like 766..>814 CDD:411020 14/83 (17%)
C2H2 Zn finger 770..795 CDD:411020 5/26 (19%)
C2H2 Zn finger 770..790 CDD:275368 5/21 (24%)
C2H2 Zn finger 798..818 CDD:275368 10/51 (20%)
zf-H2C2_2 810..834 CDD:404364 11/52 (21%)
C2H2 Zn finger 826..846 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.