DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grau and CG4707

DIOPT Version :9

Sequence 1:NP_788422.1 Gene:grau / 45871 FlyBaseID:FBgn0001133 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_611944.1 Gene:CG4707 / 37935 FlyBaseID:FBgn0035036 Length:673 Species:Drosophila melanogaster


Alignment Length:678 Identity:194/678 - (28%)
Similarity:291/678 - (42%) Gaps:167/678 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDICRLCLRGVSGAQMCLQIFDVDSGESKVAEVLRQHFWF-EVLPNDEISKVICNVCWTQVSEFH 64
            |.:|.|||.. |.|...||  ..:.....:...:.:||.| |||.....::| |..||..||.|.
  Fly     1 MTVCVLCLDS-SNAGYGLQ--SEEGVRLNIRATIHKHFAFSEVLTAGGDAEV-CRECWNCVSSFE 61

  Fly    65 QFY--VSIQEAQVIYATTSKFKQDP---------EMVNTSWPEEVLMPADVLAVDNDVGAQIN-V 117
            :|:  ||....|    .:|..|.:|         .::|..:..|:...|:.....::|..::| :
  Fly    62 EFHQRVSCLHRQ----RSSDSKSEPIEFCGQTEEAIINPLYSVELDALAEAFFAPSEVKVEVNEL 122

  Fly   118 NPLDELDLSQ----------------------------------------PMS------------ 130
            .||.:::|.:                                        |::            
  Fly   123 EPLPKVELLEDPVKTEIRTAPKRLGVPNEGSPHSKRRIKNELPVDSDSDAPLADFLNSDSKRSSV 187

  Fly   131 ---------------------------PE---------DSKVGIKTERQSPDMELL-------FE 152
                                       ||         ||:.|.:..|.:.|||.:       .:
  Fly   188 GPAKNSEANKGRQLRRSARRGRPPKAKPESAPSPKKELDSEDGEENARDNNDMEFVAPEAVLGTD 252

  Fly   153 DANNEQDEDYEDDEDDDTDDL-IVTRSGRKRKRDVAKPAKTKRGTVSVGRKGKEKMVVKRGPPKR 216
            |:::...|...:|.|....|: ...|.....||.|.||.|.::         :||.:|   ||.|
  Fly   253 DSSSSSSESSGEDSDHSLPDIEPEERYAEIPKRVVVKPKKYRK---------REKPLV---PPVR 305

  Fly   217 IFKMERLPPFCKEDE--ELIKRYI-VMGCELCIFLAEDFDGIREHFKDKHPDERPYIKCCGRKLN 278
            :.:.|......::||  |:|.::. ...|.||..|.::|..:|.|.:..|..|..||:|||||.:
  Fly   306 LSREEIERRKLQQDEYDEIILQFFKKFPCSLCNLLVQNFADMRRHQRVSHNIESGYIECCGRKFH 370

  Fly   279 KRCLIQEHARRHENPEYIKCKDCGKVFANSSVLRAHWLVHHVPDEECD------FQCEDCGKRFS 337
            .|..:.||...|:||::..|..||:||.:|..|..|...|..|:.:.:      :|||.|.|.|:
  Fly   371 LRKALAEHVLVHKNPDHFMCSQCGRVFQDSRALEVHEQTHTNPEVKAEPKEKRIYQCEKCPKSFT 435

  Fly   338 RRNLLELHKGS-HVPVNERKFICPQCPKHNAFATEYHMQVHISMQH-RKAANICHVCGKKIKDKA 400
            .:..:|.|..| |||.:|.|:.||:|.|  ...||..::.|:...| .:||.||..|||.::.:.
  Fly   436 TKAAMEYHDVSKHVPKSEFKYSCPECNK--KIPTERKLKEHLRYMHDPEAAIICDKCGKTLRSQT 498

  Fly   401 VFEKHVRLHFEESGPRIKCPRPD------CESWLKDEDNLKQHLRR-HNDEGKLFICSECGKSCK 458
            ..:||..|...|. ||   |:||      |.:||:....||||::. |...|....|..|.|:..
  Fly   499 NLKKHHELEHSEK-PR---PKPDPVQCEICGTWLRHLSGLKQHMKTVHEPPGDEHRCHICNKTST 559

  Fly   459 NSRALIGHKRYSHSNVI----YTCEQCGKTFKKDISLKEHMAQHTGEPLYKCPFCPRTFNSNANM 519
            |||||   ||:.:.|.:    :.|..|.|.||:...|:||.:.||||.||.||.||.||.|||||
  Fly   560 NSRAL---KRHIYHNHLCERKFKCGMCEKAFKRPQDLREHTSTHTGEVLYTCPNCPMTFFSNANM 621

  Fly   520 HSHKKKMHPVEWDIWRKTKTGSSQKVLP 547
            :.|::::|..||:..||       |.||
  Fly   622 YKHRQRLHRAEWEADRK-------KPLP 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grauNP_788422.1 zf-AD 3..77 CDD:285071 25/76 (33%)
C2H2 Zn finger 272..290 CDD:275368 8/17 (47%)
COG5048 <296..453 CDD:227381 58/171 (34%)
C2H2 Zn finger 298..318 CDD:275368 8/19 (42%)
SIR2 <316..>415 CDD:294129 35/106 (33%)
C2H2 Zn finger 329..349 CDD:275368 8/20 (40%)
C2H2 Zn finger 359..409 CDD:275368 17/50 (34%)
C2H2 Zn finger 360..378 CDD:275370 5/17 (29%)
zf-C2H2_8 419..495 CDD:292531 30/86 (35%)
C2H2 Zn finger 450..471 CDD:275368 10/20 (50%)
C2H2 Zn finger 478..498 CDD:275368 8/19 (42%)
C2H2 Zn finger 506..524 CDD:275368 12/17 (71%)
CG4707NP_611944.1 zf-AD 3..73 CDD:285071 24/73 (33%)
C2H2 Zn finger 334..355 CDD:275368 7/20 (35%)
LIM <361..407 CDD:295319 20/45 (44%)
C2H2 Zn finger 365..382 CDD:275368 7/16 (44%)
C2H2 Zn finger 390..410 CDD:275368 8/19 (42%)
C2H2 Zn finger 427..443 CDD:275368 6/15 (40%)
C2H2 Zn finger 458..476 CDD:275368 7/19 (37%)
C2H2 Zn finger 487..507 CDD:275368 6/19 (32%)
C2H2 Zn finger 521..540 CDD:275368 7/18 (39%)
C2H2 Zn finger 551..572 CDD:275368 10/23 (43%)
C2H2 Zn finger 580..600 CDD:275368 8/19 (42%)
C2H2 Zn finger 608..629 CDD:275368 12/20 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.