DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grau and CG1663

DIOPT Version :9

Sequence 1:NP_788422.1 Gene:grau / 45871 FlyBaseID:FBgn0001133 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster


Alignment Length:218 Identity:60/218 - (27%)
Similarity:88/218 - (40%) Gaps:48/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 HWLVHHVPDEECDFQ-CEDCGKRFSRRNLLELHKGSHVPVNERKFICPQCPKHNAFATEYHMQVH 377
            |.|:..:|....... ||:|.:||....||.|||                           .:||
  Fly   185 HSLLKFMPTNHISVTICEECDRRFLNERLLRLHK---------------------------FRVH 222

  Fly   378 ISMQHRKAANICHVCGKKIKDKAVFEKH-VRLHFEESGPRIKCPRPDCES---WLKDEDNLKQHL 438
            ....    .|:||||.:.....:..|:| .|.||:.  |..:|.|.|..:   |     :.:||.
  Fly   223 GGPN----PNVCHVCHQSFPLASKLEQHQARYHFKR--PEWQCSRCDYNAPSKW-----DFQQHQ 276

  Fly   439 RRHNDEGKLFICSECGKSCKNSRALIGHKRYSHSNVIYTCEQCGKTFKKDISLKEHMAQ-HTGEP 502
            ..|..: :.:||..||.|.|.|.||..|:| :|......|..|.:.|:::.:||.|:.: |.|..
  Fly   277 AMHAGQ-RNYICELCGHSSKTSSALAVHRR-THDQPKLCCPHCSRQFRENSTLKSHIRKIHDGNS 339

  Fly   503 L--YKCPFCPRTFNSNANMHSHK 523
            .  ..|.||.|.|.:...:..||
  Fly   340 ARQVSCDFCWRRFKTLELLKLHK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grauNP_788422.1 zf-AD 3..77 CDD:285071
C2H2 Zn finger 272..290 CDD:275368
COG5048 <296..453 CDD:227381 35/143 (24%)
C2H2 Zn finger 298..318 CDD:275368 2/3 (67%)
SIR2 <316..>415 CDD:294129 24/100 (24%)
C2H2 Zn finger 329..349 CDD:275368 10/19 (53%)
C2H2 Zn finger 359..409 CDD:275368 10/50 (20%)
C2H2 Zn finger 360..378 CDD:275370 1/17 (6%)
zf-C2H2_8 419..495 CDD:292531 24/78 (31%)
C2H2 Zn finger 450..471 CDD:275368 10/20 (50%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
C2H2 Zn finger 506..524 CDD:275368 7/18 (39%)
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511
C2H2 Zn finger 201..222 CDD:275368 10/47 (21%)
C2H2 Zn finger 259..279 CDD:275368 6/24 (25%)
C2H2 Zn finger 287..307 CDD:275368 10/20 (50%)
C2H2 Zn finger 314..335 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.