DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grau and fezf-1

DIOPT Version :9

Sequence 1:NP_788422.1 Gene:grau / 45871 FlyBaseID:FBgn0001133 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_502594.2 Gene:fezf-1 / 3564888 WormBaseID:WBGene00012639 Length:218 Species:Caenorhabditis elegans


Alignment Length:232 Identity:62/232 - (26%)
Similarity:98/232 - (42%) Gaps:44/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 EKMVVKRGPPKRIFKMERLPPF-------------CKEDEELIKRYIVMGCELCIFLAEDFDGIR 256
            |.::.....||.:.:...:.||             ..:||...|::   .||:|   .:.|:.  
 Worm     7 EVLLADSPSPKSLCRSSGIFPFPLPSSNSIFAESSSGDDENSRKKF---PCEIC---GKQFNA-- 63

  Fly   257 EHFK-----DKHPDERPYI-KCCGRKLNKRCLIQEHARRHENPEYIKCKDCGKVFANSSVLRAHW 315
             |:.     ..|..|||:: |.||:...:...:..|...|.:.:..|||.|||.|..||.|..|.
 Worm    64 -HYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCFNRSSTLNTHV 127

  Fly   316 LVHH--VPDEECDFQCEDCGKRFSRRNLLELHKGSHVPVNERKFICPQCPK--HNAFATEYHMQV 376
            .:|.  .|     |.||.|||.|.:....:.|:.:|  .:.:||.|..|.:  |.::...:||..
 Worm   128 RIHQGFKP-----FVCEICGKGFHQNGNYKNHRLTH--EDTKKFSCSICSRAFHQSYNLAFHMFT 185

  Fly   377 HISMQHRKAANICHVCGKKIKDKAVFEKHVR-LHFEE 412
            |  .:|:...  ||||.|........:||:| :|..:
 Worm   186 H--EEHKPFT--CHVCSKGFCRNFDLKKHLRKMHMTQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grauNP_788422.1 zf-AD 3..77 CDD:285071
C2H2 Zn finger 272..290 CDD:275368 3/17 (18%)
COG5048 <296..453 CDD:227381 40/122 (33%)
C2H2 Zn finger 298..318 CDD:275368 10/19 (53%)
SIR2 <316..>415 CDD:294129 29/102 (28%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
C2H2 Zn finger 359..409 CDD:275368 15/52 (29%)
C2H2 Zn finger 360..378 CDD:275370 4/19 (21%)
zf-C2H2_8 419..495 CDD:292531
C2H2 Zn finger 450..471 CDD:275368
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 506..524 CDD:275368
fezf-1NP_502594.2 COG5048 <13..212 CDD:227381 59/218 (27%)
DUF3449 <50..>70 CDD:288759 6/28 (21%)
C2H2 Zn finger 54..74 CDD:275368 5/25 (20%)
zf-H2C2_2 66..91 CDD:290200 7/24 (29%)
C2H2 Zn finger 82..102 CDD:275368 4/19 (21%)
C2H2 Zn finger 110..130 CDD:275368 10/19 (53%)
C2H2 Zn finger 138..158 CDD:275368 7/19 (37%)
C2H2 Zn finger 166..186 CDD:275368 5/19 (26%)
C2H2 Zn finger 194..212 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.