DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grau and CG11696

DIOPT Version :9

Sequence 1:NP_788422.1 Gene:grau / 45871 FlyBaseID:FBgn0001133 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:634 Identity:186/634 - (29%)
Similarity:280/634 - (44%) Gaps:110/634 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ICRLCLRGVSGAQMCLQIFDVD-----SGESKVAEVLRQHFWFEVLPNDEISKVICNVCWTQVSE 62
            ||||||   ..|:..:.||..:     ....::||::.:|....:..||.:|..:||.||.|::|
  Fly     2 ICRLCL---EDAEHGVPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAE 63

  Fly    63 FHQFYVSIQEAQVIYATTSKFKQD-PEMVNTSWPEEVLM-------------------------- 100
            ..||...:.|.|.....:.:.|.: ||:...:.||..|:                          
  Fly    64 IEQFCSMVAEKQRSLHRSLQLKTELPELPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHILCE 128

  Fly   101 PA-DVLAV----DNDVG--AQINVNPLDELDLSQ-----PMSP---------------------- 131
            |. |.|:.    |:|.|  .:.:..|..:.|..:     |:.|                      
  Fly   129 PVIDALSAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQIIKRKY 193

  Fly   132 ----EDSKVGIK----TERQSPDMELLFEDANNEQDEDYEDDEDDDTD---DLIVTRSGRKRKRD 185
                :.:|..|.    .|.::...||....|..|.|:|.::||:|:.|   :|......:.:.|.
  Fly   194 EKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQPKPRG 258

  Fly   186 VAKPAKTKRGTVSVGRKGKEKMVVKRGPPKRIFKMERLPPFCKEDEELIKRYIVMGCELCIFLAE 250
            .....|||:...:.......::.|||..             .||.::.|...:.:.|.:|....|
  Fly   259 KRGRPKTKKLVTADDNDDTSEVPVKRSS-------------IKEMDDYIAANVKLDCAICAAPLE 310

  Fly   251 DFDGIREHFKDKHPDERPYIKCCGRKLNKRCLIQEHARRHENPEYIKCKDCGKVFANSSVLRAHW 315
            ||:.::.||:.:| |...|:|||..:..||.|..:|...|::|:|..|:.|.|.|.|.:....|.
  Fly   311 DFNDLKRHFRVEH-DCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHM 374

  Fly   316 LVHHVPDEECDFQCEDCGKRFSRRNLLELHKGSHVPVNERKFICPQCPKHNAFATEYHMQVHISM 380
            |..|...:|...||..|..||:::.||.:|...| ...||..:|..|.|  .|.|::.:..|:..
  Fly   375 LRFHSQQQELVHQCAICEARFAKKFLLTMHLKGH-KGTERPEVCDTCSK--TFRTKFELSAHVKR 436

  Fly   381 QHRKAAN----ICHVCGKKIKDKAVFEKHVR-LHFEESGPRIKCPRPDCESWLKDEDNLKQHLRR 440
            .|  ||:    ||.:||...:.||.|..|.: ||.:.....::|..  |..||:||.:|::||.|
  Fly   437 MH--AADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTL--CGRWLRDERSLRKHLAR 497

  Fly   441 HND-EGKL-FICSECGKSCKNSRALIGHKRYSHSNVIYTCEQCGKTFKKDISLKEHMAQHTGEPL 503
            |:| :|.. :.|..|.....:..||..|.||.||...:.|..|.|.||...:|.||||.|||..|
  Fly   498 HDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDL 562

  Fly   504 YKCPFCPRTFNSNANMHSHKKKMHPVEWDIWRKTKTGSSQKVLPSAQVA 552
            |:|.||.|||.|:||||:|||||||.:|  .||....||.....:|.:|
  Fly   563 YQCQFCTRTFKSHANMHNHKKKMHPNDW--VRKYSQPSSSITSTAAPLA 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grauNP_788422.1 zf-AD 3..77 CDD:285071 25/78 (32%)
C2H2 Zn finger 272..290 CDD:275368 6/17 (35%)
COG5048 <296..453 CDD:227381 53/163 (33%)
C2H2 Zn finger 298..318 CDD:275368 7/19 (37%)
SIR2 <316..>415 CDD:294129 33/103 (32%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
C2H2 Zn finger 359..409 CDD:275368 17/54 (31%)
C2H2 Zn finger 360..378 CDD:275370 4/17 (24%)
zf-C2H2_8 419..495 CDD:292531 29/77 (38%)
C2H2 Zn finger 450..471 CDD:275368 7/20 (35%)
C2H2 Zn finger 478..498 CDD:275368 10/19 (53%)
C2H2 Zn finger 506..524 CDD:275368 12/17 (71%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 25/78 (32%)
C2H2 Zn finger 332..349 CDD:275368 5/16 (31%)
C2H2 Zn finger 357..378 CDD:275368 7/20 (35%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
C2H2 Zn finger 417..438 CDD:275368 6/22 (27%)
C2H2 Zn finger 447..465 CDD:275368 7/17 (41%)
C2H2 Zn finger 478..498 CDD:275368 9/21 (43%)
C2H2 Zn finger 509..529 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 10/19 (53%)
C2H2 Zn finger 565..583 CDD:275368 12/17 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.