DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grau and ZNF544

DIOPT Version :9

Sequence 1:NP_788422.1 Gene:grau / 45871 FlyBaseID:FBgn0001133 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001374339.1 Gene:ZNF544 / 27300 HGNCID:16759 Length:769 Species:Homo sapiens


Alignment Length:329 Identity:96/329 - (29%)
Similarity:143/329 - (43%) Gaps:39/329 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 HPDERPYIKC--CGRKLNKRCLIQEHARRHENPEYIKCKDCGKVFANSSVLRAHWLVHHVPDEEC 325
            |..|:|| :|  ||:...:|..:..|.|.|...:..:|.:|.|.|..:|.|..|..:|   ..|.
Human   456 HTGEKPY-ECDLCGKSFTQRSKLITHQRIHTGEKPYQCIECRKSFRWNSNLIVHQRIH---TGEK 516

  Fly   326 DFQCEDCGKRFSRRNLLELHKGSHVPVNERKFICPQCPKHNAFATEYHMQVHISMQHRKAANICH 390
            .::|..|||.||:...|..||.:|  ..|:.|.|.||.|  :|:.:|.:.||......:....|:
Human   517 PYECTHCGKSFSQSYELVTHKRTH--TGEKPFKCTQCGK--SFSQKYDLVVHQRTHTGEKPYECN 577

  Fly   391 VCGKKIKDKAVFEKHVRLHFEESGPRIKCPRP----DCESWLKDEDNLKQHLRRHNDEGKLFICS 451
            :|||.....:....|.|:|..|        :|    :|....:...||..|.|.|..| |.:.|:
Human   578 LCGKSFSQSSKLITHQRIHTGE--------KPYQCIECGKSFRWNSNLVIHQRIHTGE-KPYDCT 633

  Fly   452 ECGKSCKNSRALIGHKRYSHSNVIYTCEQCGKTFKKDISLKEHMAQHTGEPLYKCPFCPRTFNSN 516
            .||||...|..|:.|||.......|.|.:|||.|.:...|..|:..||||..|||..|.:.|..:
Human   634 HCGKSFSQSYQLVAHKRTHTGEKPYECNECGKAFNRSTQLIRHLQIHTGEKPYKCNQCNKAFARS 698

  Fly   517 ANMHSHKKKMH----PVEWDIWRKTKTGSS-----------QKVLPSAQVAQMFRDDADVAAIAN 566
            :.:..| ::.|    |.|.....|..:|||           :|....:...:.||..:.:.....
Human   699 SYLVMH-QRTHTGEKPFECSQCGKAFSGSSNLLSHHRIHSGEKPYECSDCGKSFRQQSQLVVHRR 762

  Fly   567 DYSG 570
            .::|
Human   763 THTG 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grauNP_788422.1 zf-AD 3..77 CDD:285071
C2H2 Zn finger 272..290 CDD:275368 6/19 (32%)
COG5048 <296..453 CDD:227381 47/160 (29%)
C2H2 Zn finger 298..318 CDD:275368 7/19 (37%)
SIR2 <316..>415 CDD:294129 30/98 (31%)
C2H2 Zn finger 329..349 CDD:275368 9/19 (47%)
C2H2 Zn finger 359..409 CDD:275368 14/49 (29%)
C2H2 Zn finger 360..378 CDD:275370 6/17 (35%)
zf-C2H2_8 419..495 CDD:292531 26/79 (33%)
C2H2 Zn finger 450..471 CDD:275368 10/20 (50%)
C2H2 Zn finger 478..498 CDD:275368 7/19 (37%)
C2H2 Zn finger 506..524 CDD:275368 4/17 (24%)
ZNF544NP_001374339.1 KRAB 68..127 CDD:214630
C2H2 Zn finger 410..428 CDD:275368
zf-H2C2_2 424..445 CDD:404364
C2H2 Zn finger 436..456 CDD:275368 96/329 (29%)
COG5048 460..>753 CDD:227381 92/310 (30%)
C2H2 Zn finger 464..484 CDD:275368 6/19 (32%)
C2H2 Zn finger 492..512 CDD:275368 7/19 (37%)
C2H2 Zn finger 520..540 CDD:275368 9/19 (47%)
C2H2 Zn finger 548..568 CDD:275368 8/21 (38%)
C2H2 Zn finger 576..596 CDD:275368 6/19 (32%)
C2H2 Zn finger 604..624 CDD:275368 5/19 (26%)
C2H2 Zn finger 632..652 CDD:275368 10/19 (53%)
C2H2 Zn finger 660..680 CDD:275368 7/19 (37%)
C2H2 Zn finger 688..708 CDD:275368 4/20 (20%)
C2H2 Zn finger 716..736 CDD:275368 4/19 (21%)
C2H2 Zn finger 744..764 CDD:275368 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.