DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grau and LOC101882402

DIOPT Version :9

Sequence 1:NP_788422.1 Gene:grau / 45871 FlyBaseID:FBgn0001133 Length:570 Species:Drosophila melanogaster
Sequence 2:XP_021327019.1 Gene:LOC101882402 / 101882402 -ID:- Length:375 Species:Danio rerio


Alignment Length:364 Identity:91/364 - (25%)
Similarity:129/364 - (35%) Gaps:80/364 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 AKTKRGTVSVGRKGKEKMVVKRGPPKRIFKMERLPPFCKEDEELIKRYIVMGCELCIFLAEDFDG 254
            ||||    |:.||.|:::.                                 |..|.....:.:.
Zfish    11 AKTK----SLKRKDKKRVT---------------------------------CTQCGKSLANKEN 38

  Fly   255 IREHFKDKHPDERPYIKC--CGRKLNKRCLIQEHARRHENPEYIKCKDCGKVFANSSVLRAHWLV 317
            ::.|.: .|..|||: .|  ||:.......:..|...|...:..||..|||.|..:|.|..|..|
Zfish    39 LKSHMR-IHTGERPF-TCSQCGKGFRDASNLSRHMLIHFGEKTHKCDQCGKSFLLASSLNDHLRV 101

  Fly   318 HHVPDEECDFQCEDCGKRFSRRNLLELHKGSHVPVNERKFICPQCPKHNAFATEYHMQVHISMQH 382
            |......|..    |||.|:....|..|:..|..|  |:::|.:|.|  .|.|...:|.|..:..
Zfish   102 HSTEKPSCSV----CGKSFAYEGNLRKHQKIHTGV--REYVCSECGK--TFITSTSLQQHQMIHT 158

  Fly   383 RKAANICHVCGKKIKDKAVFEKHVRLHFEESGPRIKCPRPDCESWLKDEDNLKQHLRRHNDE--- 444
            .:...||..|..:....:..:.|.|:|..|.  ..||..  |:.......:.|.|.|.|..|   
Zfish   159 GEKPYICSHCSMRFSQFSHLKTHERIHTGEK--PYKCSH--CDKRFTQLGSQKTHERTHTGEKLY 219

  Fly   445 ------------------------GKLFICSECGKSCKNSRALIGHKRYSHSNVIYTCEQCGKTF 485
                                    .|.::||.|......|..:..|:|.......|.|..|.|.|
Zfish   220 KCSLCNVRFGHLLSLRTHERIHTGEKPYMCSHCDMRFSQSSQMKSHERIHTGEKPYKCSHCDKRF 284

  Fly   486 KKDISLKEHMAQHTGEPLYKCPFCPRTFNSNANMHSHKK 524
            .:..|.|.|...||||..|||..|...||..|::.||::
Zfish   285 NQLGSQKRHERTHTGERPYKCSHCDNRFNQIAHLKSHER 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grauNP_788422.1 zf-AD 3..77 CDD:285071
C2H2 Zn finger 272..290 CDD:275368 4/19 (21%)
COG5048 <296..453 CDD:227381 46/183 (25%)
C2H2 Zn finger 298..318 CDD:275368 8/19 (42%)
SIR2 <316..>415 CDD:294129 26/98 (27%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
C2H2 Zn finger 359..409 CDD:275368 12/49 (24%)
C2H2 Zn finger 360..378 CDD:275370 5/17 (29%)
zf-C2H2_8 419..495 CDD:292531 21/102 (21%)
C2H2 Zn finger 450..471 CDD:275368 6/20 (30%)
C2H2 Zn finger 478..498 CDD:275368 7/19 (37%)
C2H2 Zn finger 506..524 CDD:275368 7/17 (41%)
LOC101882402XP_021327019.1 COG5048 26..>333 CDD:227381 83/312 (27%)
C2H2 Zn finger 26..46 CDD:275368 3/20 (15%)
C2H2 Zn finger 54..74 CDD:275368 4/19 (21%)
C2H2 Zn finger 82..102 CDD:275368 8/19 (42%)
C2H2 Zn finger 109..129 CDD:275368 7/23 (30%)
C2H2 Zn finger 137..157 CDD:275368 7/21 (33%)
C2H2 Zn finger 165..185 CDD:275368 4/19 (21%)
C2H2 Zn finger 193..213 CDD:275368 5/21 (24%)
C2H2 Zn finger 221..241 CDD:275368 0/19 (0%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
C2H2 Zn finger 305..325 CDD:275368 7/19 (37%)
C2H2 Zn finger 333..353 CDD:275368
C2H2 Zn finger 358..374 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D448547at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.