DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)2 and AT3G27100

DIOPT Version :9

Sequence 1:NP_524846.1 Gene:e(y)2 / 45848 FlyBaseID:FBgn0000618 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_189346.2 Gene:AT3G27100 / 822329 AraportID:AT3G27100 Length:115 Species:Arabidopsis thaliana


Alignment Length:76 Identity:33/76 - (43%)
Similarity:51/76 - (67%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLTGDRSKIKDLLCSRLTECGWRDEVRLMCRNILMEKGTNNSFTVEQLIAEVTPKARTLVPDAVK 76
            |.:|::..:.:|:..||.||||:||:|:.||..:.:|| ....||::||..:|||.|..|||:||
plant    36 VESGEKENLMELVRDRLVECGWKDEMRIACREHVKKKG-RKDVTVDELIRVITPKGRASVPDSVK 99

  Fly    77 KELLMKIRTIL 87
            .|||.:|:..:
plant   100 AELLNRIQNFI 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)2NP_524846.1 EnY2 6..87 CDD:287172 33/74 (45%)
AT3G27100NP_189346.2 EnY2 29..110 CDD:287172 33/74 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3342
eggNOG 1 0.900 - - E1_KOG4479
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2452
OMA 1 1.010 - - QHG54942
OrthoDB 1 1.010 - - D1538551at2759
OrthoFinder 1 1.000 - - FOG0004955
OrthoInspector 1 1.000 - - otm3585
orthoMCL 1 0.900 - - OOG6_103619
Panther 1 1.100 - - LDO PTHR12514
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5291
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.