DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)2 and Eny2

DIOPT Version :9

Sequence 1:NP_524846.1 Gene:e(y)2 / 45848 FlyBaseID:FBgn0000618 Length:101 Species:Drosophila melanogaster
Sequence 2:XP_038935818.1 Gene:Eny2 / 685258 RGDID:1596439 Length:105 Species:Rattus norvegicus


Alignment Length:84 Identity:41/84 - (48%)
Similarity:64/84 - (76%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVDQYTVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRNILMEKGTNNSFTVEQLIAEVTPKARTL 70
            |::|..:.||:|.::|:||.::|.||||:|:::..|:.::.|||..: .||:.|:||:|||.|.|
  Rat    19 AINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEH-VTVDDLVAEITPKGRAL 82

  Fly    71 VPDAVKKELLMKIRTILTE 89
            |||:||||||.:|||.|.:
  Rat    83 VPDSVKKELLQRIRTFLAQ 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)2NP_524846.1 EnY2 6..87 CDD:287172 40/80 (50%)
Eny2XP_038935818.1 EnY2 20..98 CDD:401971 38/78 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354402
Domainoid 1 1.000 93 1.000 Domainoid score I7384
eggNOG 1 0.900 - - E1_KOG4479
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I4978
OMA 1 1.010 - - QHG54942
OrthoDB 1 1.010 - - D1538551at2759
OrthoFinder 1 1.000 - - FOG0004955
OrthoInspector 1 1.000 - - oto98017
orthoMCL 1 0.900 - - OOG6_103619
Panther 1 1.100 - - LDO PTHR12514
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5291
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.