DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)2 and e(y)2b

DIOPT Version :9

Sequence 1:NP_524846.1 Gene:e(y)2 / 45848 FlyBaseID:FBgn0000618 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001287204.1 Gene:e(y)2b / 50143 FlyBaseID:FBgn0040670 Length:95 Species:Drosophila melanogaster


Alignment Length:77 Identity:32/77 - (41%)
Similarity:55/77 - (71%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRNILMEKGTNNSFTVEQLIAEVTPKARTLVPDAV 75
            |:.:.|::.:|:||.:||.||||..:::.|.|||:||:|.:| ...:||.|::.|:||.|||:.|
  Fly    18 TLRSQDKAALKELLHTRLVECGWHKDIKEMIRNIIMERGVDN-INRDQLAAQIVPQARALVPEVV 81

  Fly    76 KKELLMKIRTIL 87
            |.|:::::...|
  Fly    82 KNEMMLRVHAAL 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)2NP_524846.1 EnY2 6..87 CDD:287172 31/75 (41%)
e(y)2bNP_001287204.1 EnY2 19..93 CDD:287172 30/74 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I3064
eggNOG 1 0.900 - - E1_KOG4479
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538551at2759
OrthoFinder 1 1.000 - - FOG0004955
OrthoInspector 1 1.000 - - otm3585
orthoMCL 1 0.900 - - OOG6_103619
Panther 1 1.100 - - P PTHR12514
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.