DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)2 and eny2

DIOPT Version :9

Sequence 1:NP_524846.1 Gene:e(y)2 / 45848 FlyBaseID:FBgn0000618 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001002427.1 Gene:eny2 / 436700 ZFINID:ZDB-GENE-040718-124 Length:95 Species:Danio rerio


Alignment Length:84 Identity:42/84 - (50%)
Similarity:62/84 - (73%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVDQYTVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRNILMEKGTNNSFTVEQLIAEVTPKARTL 70
            |::|..:..|:|.::|:||.::|.||||||:::.:|:.::.|||..| .|||.|:|.||||.|.|
Zfish    10 AINQKLIEMGERERLKELLRAKLIECGWRDQLKALCKEVIKEKGIEN-VTVEDLVAGVTPKGRAL 73

  Fly    71 VPDAVKKELLMKIRTILTE 89
            |||:||||||.:||..|.:
Zfish    74 VPDSVKKELLQRIRAFLAQ 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)2NP_524846.1 EnY2 6..87 CDD:287172 41/80 (51%)
eny2NP_001002427.1 EnY2 11..89 CDD:401971 40/78 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596703
Domainoid 1 1.000 92 1.000 Domainoid score I7628
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I5068
OMA 1 1.010 - - QHG54942
OrthoDB 1 1.010 - - D1538551at2759
OrthoFinder 1 1.000 - - FOG0004955
OrthoInspector 1 1.000 - - oto39659
orthoMCL 1 0.900 - - OOG6_103619
Panther 1 1.100 - - LDO PTHR12514
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1416
SonicParanoid 1 1.000 - - X5291
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.