DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)2 and sus1

DIOPT Version :9

Sequence 1:NP_524846.1 Gene:e(y)2 / 45848 FlyBaseID:FBgn0000618 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001018822.1 Gene:sus1 / 3361305 PomBaseID:SPBC6B1.12c Length:108 Species:Schizosaccharomyces pombe


Alignment Length:96 Identity:27/96 - (28%)
Similarity:49/96 - (51%) Gaps:6/96 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTSGAVDQ-YTVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRNILMEKGTNNSFTVEQLIAEVT 64
            |:|...|:| |.  |||..::.:.|..:|..|||..::|...|.|:   .:::....::|.....
pombe    10 MTTEKIVEQLYE--TGDYERLANELEYKLESCGWTTQLRDYTRGIV---NSDSKIDFQKLYESAL 69

  Fly    65 PKARTLVPDAVKKELLMKIRTILTEIEEEPD 95
            ..|...:||:||.:||..|:|.:.::...|:
pombe    70 QSATESIPDSVKMDLLKDIKTCVLKLANPPE 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)2NP_524846.1 EnY2 6..87 CDD:287172 24/81 (30%)
sus1NP_001018822.1 EnY2 13..92 CDD:287172 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2089
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004955
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103619
Panther 1 1.100 - - LDO PTHR12514
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1416
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.950

Return to query results.
Submit another query.