DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)2 and T01C3.2

DIOPT Version :9

Sequence 1:NP_524846.1 Gene:e(y)2 / 45848 FlyBaseID:FBgn0000618 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_506686.1 Gene:T01C3.2 / 179996 WormBaseID:WBGene00011319 Length:98 Species:Caenorhabditis elegans


Alignment Length:75 Identity:19/75 - (25%)
Similarity:34/75 - (45%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TGDRSKIKDLLCSRLTECGWRDEVRLMCRNILMEKGTNNSFTVEQLIAEVTPKARTLVPDAVKKE 78
            :|:.:.:|..|.|.|....|...||...:..| || ..:..:.:::...|...||..:|...||:
 Worm    21 SGESALVKSTLLSSLQNSEWEIAVRKEVKKFL-EK-ARDDVSAKEVFDAVKDMARREIPQEAKKK 83

  Fly    79 LLMKIRTILT 88
            |..::...:|
 Worm    84 LYDQVLEFVT 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)2NP_524846.1 EnY2 6..87 CDD:287172 18/72 (25%)
T01C3.2NP_506686.1 EnY2 12..92 CDD:287172 18/72 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.