DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpo and Rbpms2

DIOPT Version :9

Sequence 1:NP_001014632.3 Gene:cpo / 45840 FlyBaseID:FBgn0263995 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_082306.2 Gene:Rbpms2 / 71973 MGIID:1919223 Length:206 Species:Mus musculus


Alignment Length:183 Identity:94/183 - (51%)
Similarity:113/183 - (61%) Gaps:36/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 EEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAAKQ 502
            |||||||||||||:|.||||||||||.::||||||:|:||:     .|||||.|.:||||||||.
Mouse    21 EEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSR-----QPVGFVIFDSRAGAEAAKN 80

  Fly   503 DLQGVRFDPDMPQTIRLEFAKSNTKVSKPK----PQPNTATTASHPALMHPLTGH-----LGGPF 558
            .|.|:||||:.|||:||||||:|||::|.|    |.|    |:.||||...|...     :|...
Mouse    81 ALNGIRFDPENPQTLRLEFAKANTKMAKSKLIATPNP----TSVHPALGAHLIARDPYDLMGTAL 141

  Fly   559 FPGGPELW-HHPLAYSAAAAAELPGAAALQHATLVHPA----------LHPQV 600
            .|..||.| .:|| |:    .||  ..|:.|.|..:||          ||.||
Mouse   142 IPASPEAWAPYPL-YT----TEL--TPAISHTTFTYPAATAAAAAAATLHAQV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpoNP_001014632.3 RRM <428..>525 CDD:223796 62/86 (72%)
RRM_cpo 441..523 CDD:241128 57/81 (70%)
RRM_scw1_like 712..819 CDD:240691
Rbpms2NP_082306.2 RRM_RBPMS2 24..99 CDD:241127 55/79 (70%)
Important for homodimerization. /evidence=ECO:0000250|UniProtKB:Q6ZRY4 35..45 8/9 (89%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7758
eggNOG 1 0.900 - - E1_KOG1457
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002113
OrthoInspector 1 1.000 - - otm43941
orthoMCL 1 0.900 - - OOG6_104919
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3149
SonicParanoid 1 1.000 - - X1401
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.700

Return to query results.
Submit another query.