DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpo and rbpms2a

DIOPT Version :9

Sequence 1:NP_001014632.3 Gene:cpo / 45840 FlyBaseID:FBgn0263995 Length:962 Species:Drosophila melanogaster
Sequence 2:XP_021326148.1 Gene:rbpms2a / 436682 ZFINID:ZDB-GENE-040718-106 Length:267 Species:Danio rerio


Alignment Length:245 Identity:104/245 - (42%)
Similarity:138/245 - (56%) Gaps:49/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 TSAVSDSNNNLNSSSSSNSNSNAIMENQMALAPLG------LSQSMDSVNTASNEEEVRTLFVSG 448
            |||:|.....|:|..|:::.::.:.....:.|.:|      ||..: ..::..:..:||||||||
Zfish    14 TSALSLPTVPLSSFLSTSTQTSLMCLRAYSTALIGQRSHCCLSAGV-CCHSGVSLFQVRTLFVSG 77

  Fly   449 LPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAAKQDLQGVRFDPDM 513
            ||:|.||||||||||.::||||||:|:|||     .|||||||.:|:||||||..|.|:||||:.
Zfish    78 LPVDIKPRELYLLFRPFKGYEGSLIKLTSK-----QPVGFVTFDSRSGAEAAKNALNGIRFDPES 137

  Fly   514 PQTIRLEFAKSNTKVSKPK--PQPNTATTASHPALMHPLTG-HL---------GGPFFPGGPELW 566
            |||:||||||:|||::|.|  ..||       |:.:||..| |.         |....|..||.|
Zfish   138 PQTLRLEFAKANTKMAKSKLMATPN-------PSNLHPALGAHFIARDPYDLTGAALIPASPEAW 195

  Fly   567 -HHPLAYSAAAAAELPGAAALQHATLVHP-------ALHPQV---PVRSY 605
             .:|| |:......||      ||...:|       |||.||   |:|.|
Zfish   196 APYPL-YTTELTPGLP------HAAFTYPAAAAAAAALHAQVRDPPMRWY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpoNP_001014632.3 RRM <428..>525 CDD:223796 60/96 (63%)
RRM_cpo 441..523 CDD:241128 58/81 (72%)
RRM_scw1_like 712..819 CDD:240691
rbpms2aXP_021326148.1 RRM_RBPMS2 70..145 CDD:241127 56/79 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7580
eggNOG 1 0.900 - - E1_KOG1457
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002113
OrthoInspector 1 1.000 - - otm24756
orthoMCL 1 0.900 - - OOG6_104919
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3149
SonicParanoid 1 1.000 - - X1401
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.700

Return to query results.
Submit another query.