DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpo and rbpms2b

DIOPT Version :9

Sequence 1:NP_001014632.3 Gene:cpo / 45840 FlyBaseID:FBgn0263995 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_956553.1 Gene:rbpms2b / 393229 ZFINID:ZDB-GENE-040426-741 Length:200 Species:Danio rerio


Alignment Length:192 Identity:98/192 - (51%)
Similarity:112/192 - (58%) Gaps:37/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 LSQSMDSV--NTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVG 487
            :|...||.  |..|.|||||||||||||.|.||||||||||.::||||||:|:|||     .|||
Zfish     1 MSVKSDSEPNNNVSLEEEVRTLFVSGLPTDIKPRELYLLFRPFKGYEGSLIKLTSK-----QPVG 60

  Fly   488 FVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPKPQPNTATTASHPAL------ 546
            ||||.:|:||||||..|.||||||:.|||:||||||:|||::|.|.......|..||||      
Zfish    61 FVTFDSRSGAEAAKNALNGVRFDPENPQTLRLEFAKANTKMAKSKLMGTPNPTNIHPALGAHFIA 125

  Fly   547 --MHPLTGHLGGPFFPGGPELW---------------HHPLAYSAAAAAELPGAAALQHATL 591
              .:.||   |....|..||.|               |....|.|||||    |||..||.:
Zfish   126 RDPYDLT---GAALIPASPEAWSPYPLYTPELSPGLPHTAFTYPAAAAA----AAAALHAQM 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpoNP_001014632.3 RRM <428..>525 CDD:223796 68/98 (69%)
RRM_cpo 441..523 CDD:241128 59/81 (73%)
RRM_scw1_like 712..819 CDD:240691
rbpms2bNP_956553.1 RRM <4..>83 CDD:223796 56/83 (67%)
RRM_RBPMS2 19..94 CDD:241127 57/79 (72%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7580
eggNOG 1 0.900 - - E1_KOG1457
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002113
OrthoInspector 1 1.000 - - otm24756
orthoMCL 1 0.900 - - OOG6_104919
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1401
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.670

Return to query results.
Submit another query.