DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpo and Rbpms

DIOPT Version :9

Sequence 1:NP_001014632.3 Gene:cpo / 45840 FlyBaseID:FBgn0263995 Length:962 Species:Drosophila melanogaster
Sequence 2:XP_006509097.1 Gene:Rbpms / 19663 MGIID:1334446 Length:261 Species:Mus musculus


Alignment Length:185 Identity:90/185 - (48%)
Similarity:113/185 - (61%) Gaps:22/185 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 QSMDSV---NTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGF 488
            |:|.:|   |:..:..:||||||||||:|.||||||||||.::||||||:|:|||     .||||
Mouse    23 QNMLAVTGRNSRVSRCKVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK-----QPVGF 82

  Fly   489 VTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPK---------PQPNTAT--TAS 542
            |:|.:|:.|||||..|.|:||||::|||:||||||:|||::|.|         |.|||..  .|.
Mouse    83 VSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPLPNTVPQFIAR 147

  Fly   543 HPALMHP-LTGHLGGPFFPGGPELWHHPLAYSAAAAAELPGAAALQHATLVHPAL 596
            .|..:.| |.||..|...|.  .|....|....|||..|.|..|:......|||:
Mouse   148 EPYALDPSLRGHFPGLEVPA--VLLRLCLGCVMAAAICLVGINAVFTGGDCHPAV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpoNP_001014632.3 RRM <428..>525 CDD:223796 61/99 (62%)
RRM_cpo 441..523 CDD:241128 56/81 (69%)
RRM_scw1_like 712..819 CDD:240691
RbpmsXP_006509097.1 RRM_RBPMS 40..115 CDD:241126 54/79 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7758
eggNOG 1 0.900 - - E1_KOG1457
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4385
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002113
OrthoInspector 1 1.000 - - otm43941
orthoMCL 1 0.900 - - OOG6_104919
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1401
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.620

Return to query results.
Submit another query.