DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpo and RBPMS

DIOPT Version :9

Sequence 1:NP_001014632.3 Gene:cpo / 45840 FlyBaseID:FBgn0263995 Length:962 Species:Drosophila melanogaster
Sequence 2:XP_016868469.1 Gene:RBPMS / 11030 HGNCID:19097 Length:264 Species:Homo sapiens


Alignment Length:250 Identity:107/250 - (42%)
Similarity:137/250 - (54%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 NSNSNAIMENQMALAPLGLSQSMDSVNTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGS 471
            |:...|..||..:.|.|             .|||||||||||||:|.||||||||||.::|||||
Human     2 NNGGKAEKENTPSEANL-------------QEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGS 53

  Fly   472 LLKVTSKNGKTASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPK---- 532
            |:|:|||     .|||||:|.:|:.|||||..|.|:||||::|||:||||||:|||::|.|    
Human    54 LIKLTSK-----QPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113

  Fly   533 PQPNTATTASHPALMHPLTGHLGGP-FFPGGPELW-HHPLAYSAAAAAELPGAA----ALQHATL 591
            |.|:|....:.|..:......|..| .:|..||:| .:|| |.|..|..||..|    |..||.:
Human   114 PNPSTPLPNTVPQFIAREPYELTVPALYPSSPEVWAPYPL-YPAELAPALPPPAFTYPASLHAQV 177

  Fly   592 VHP-----ALHPQVPVRSYLXLN---------TDKVMEQPMHQTQM-----TMPP 627
            ..|     ||.|: ||.|:| ..         ..|.::  |||...     ::||
Human   178 SSPPPAMGALCPR-PVLSHLSQEGSSNSALCLVSKWIQ--MHQAMSRGCAGSLPP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpoNP_001014632.3 RRM <428..>525 CDD:223796 61/96 (64%)
RRM_cpo 441..523 CDD:241128 56/81 (69%)
RRM_scw1_like 712..819 CDD:240691
RBPMSXP_016868469.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7852
eggNOG 1 0.900 - - E1_KOG1457
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4385
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002113
OrthoInspector 1 1.000 - - otm41893
orthoMCL 1 0.900 - - OOG6_104919
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3149
SonicParanoid 1 1.000 - - X1401
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.650

Return to query results.
Submit another query.