DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpo and rbpms2

DIOPT Version :9

Sequence 1:NP_001014632.3 Gene:cpo / 45840 FlyBaseID:FBgn0263995 Length:962 Species:Drosophila melanogaster
Sequence 2:XP_002938920.1 Gene:rbpms2 / 100038109 XenbaseID:XB-GENE-490341 Length:198 Species:Xenopus tropicalis


Alignment Length:184 Identity:95/184 - (51%)
Similarity:113/184 - (61%) Gaps:31/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 NTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGA 497
            |..:.|||||||||||||:|.||||||||||.::||||||:|:|||     .|||||||..||||
 Frog    11 NNNNIEEEVRTLFVSGLPIDIKPRELYLLFRPFKGYEGSLIKLTSK-----QPVGFVTFDNRAGA 70

  Fly   498 EAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPKPQPNTATTASHPAL--------MHPLTGHL 554
            ||||..|.|:||||:.|||:||||||:|||::|.|.......|..||||        .:.||   
 Frog    71 EAAKNALNGIRFDPENPQTLRLEFAKANTKMAKNKLMATPNPTNLHPALGAHFIARDPYDLT--- 132

  Fly   555 GGPFFPGGPELW-HHPLAYSAAAAAELPGAAALQHATLVHP-------ALHPQV 600
            |....|..||.| .:|| |:|..|..:|      ||...:|       |||.|:
 Frog   133 GAALIPASPEAWAPYPL-YTAELAPAIP------HAAFTYPAAAAAAAALHAQM 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpoNP_001014632.3 RRM <428..>525 CDD:223796 65/91 (71%)
RRM_cpo 441..523 CDD:241128 59/81 (73%)
RRM_scw1_like 712..819 CDD:240691
rbpms2XP_002938920.1 RRM_RBPMS2 19..94 CDD:241127 57/79 (72%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7427
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002113
OrthoInspector 1 1.000 - - otm49113
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1401
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.