DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bur and SPOM_SPBPB2B2.05

DIOPT Version :10

Sequence 1:NP_620114.3 Gene:bur / 45830 FlyBaseID:FBgn0000239 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_596851.2 Gene:SPOM_SPBPB2B2.05 / 2541359 PomBaseID:SPBPB2B2.05 Length:253 Species:Schizosaccharomyces pombe


Alignment Length:178 Identity:50/178 - (28%)
Similarity:80/178 - (44%) Gaps:47/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GIIISGG----PNSVYAEDAPSYDPD-------------------LFKLKIPMLGICYGMQLINK 103
            |||::||    ||. |.||   :||:                   ..|.|||:||||.|.|::|.
pombe    48 GIILAGGESVHPNR-YGED---FDPNAPKSVDVIRDSTEWGMIDFALKKKIPILGICRGCQVLNV 108

  Fly   104 EFGGTVLKKDVREDGQQNIEIETSCP-------LFSRLSRTQSVL--------LTHGDSVERVGE 153
            .|||: |.::|...|.::|. ..|.|       :.::..:.:::|        ..|...::.:|.
pombe   109 YFGGS-LYQNVSSCGFRDIH-RPSKPRHYLAHKVMAKPGKLKNILGSNVIDVNSIHDQGIKTLGM 171

  Fly   154 NLKIGGWSTNRIVTAIYNEVLRIYGVQFHPEVDLTINGKQMLSNFLYE 201
            .|:....|.:.:...|.::...|.|||:|||   .|..||..|..|::
pombe   172 GLQSTVISDDGLCEGIESKDGLIIGVQWHPE---AIIDKQPHSLKLFQ 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
burNP_620114.3 guaA 16..683 CDD:234614 50/178 (28%)
GMP_synt_C 494..551 CDD:425963
SPOM_SPBPB2B2.05NP_596851.2 PuuD 17..223 CDD:441674 50/178 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.